Recombinant Human PGM2L1 protein, His-tagged
| Cat.No. : | PGM2L1-3297H |
| Product Overview : | Recombinant Human PGM2L1 protein(269-622 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 269-622 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | GHDYVQLAFKVFGFKPPIPVPEQKDPDPDFSTVKCPNPEEGESVLELSLRLAEKENARVVLATDPDADRLAAAELQENGCWKVFTGNELAALFGWWMFDCWKKNKSRNADVKNVYMLATTVSSKILKAIALKEGFHFEETLPGFKWIGSRIIDLLENGKEVLFAFEESIGFLCGTSVLDKDGVSAAVVVAEMASYLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDITTGYDSSQPNKKSVLPVSKNSQMITFTFQNGCVATLRTSGTEPKIKYYAEMCASPDQSDTALLEEELKKLIDALIENFLQPSKNGLIWRSV |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PGM2L1 phosphoglucomutase 2-like 1 [ Homo sapiens ] |
| Official Symbol | PGM2L1 |
| Synonyms | PGM2L1; phosphoglucomutase 2-like 1; glucose 1,6-bisphosphate synthase; BM32A; FLJ32029; glucose 1; 6 bisphosphate synthase; PMMLP; phosphoglucomutase-2-like 1; glucose-1,6-bisphosphate synthase; |
| Gene ID | 283209 |
| mRNA Refseq | NM_173582 |
| Protein Refseq | NP_775853 |
| MIM | 611610 |
| UniProt ID | Q6PCE3 |
| ◆ Recombinant Proteins | ||
| PGM2L1-6670M | Recombinant Mouse PGM2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PGM2L1-12692M | Recombinant Mouse PGM2L1 Protein | +Inquiry |
| PGM2L1-3211R | Recombinant Rhesus Macaque PGM2L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PGM2L1-3393R | Recombinant Rhesus monkey PGM2L1 Protein, His-tagged | +Inquiry |
| PGM2L1-5687Z | Recombinant Zebrafish PGM2L1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGM2L1-3250HCL | Recombinant Human PGM2L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGM2L1 Products
Required fields are marked with *
My Review for All PGM2L1 Products
Required fields are marked with *
