Recombinant Human PGPEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PGPEP1-6070H
Product Overview : PGPEP1 MS Standard C13 and N15-labeled recombinant protein (NP_060182) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The gene encodes a cysteine protease and member of the peptidase C15 family of proteins. The encoded protein cleaves amino terminal pyroglutamate residues from protein substrates including thyrotropin-releasing hormone and other neuropeptides. Expression of this gene may be downregulated in colorectal cancer, while activity of the encoded protein may be negatively correlated with cancer progression in colorectal cancer patients. Activity of the encoded protease may also be altered in other disease states including in liver cirrhosis, which is associated with reduced protease activity, and in necrozoospermia, which is associated with elevated protease activity.
Molecular Mass : 23 kDa
AA Sequence : MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PGPEP1 pyroglutamyl-peptidase I [ Homo sapiens (human) ]
Official Symbol PGPEP1
Synonyms PGPEP1; pyroglutamyl-peptidase I; Pcp; PGP; PGP I; PGPI; PGP-I;
Gene ID 54858
mRNA Refseq NM_017712
Protein Refseq NP_060182
MIM 610694
UniProt ID Q9NXJ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGPEP1 Products

Required fields are marked with *

My Review for All PGPEP1 Products

Required fields are marked with *

0
cart-icon