Recombinant Human PGPEP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PGPEP1-6070H |
Product Overview : | PGPEP1 MS Standard C13 and N15-labeled recombinant protein (NP_060182) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The gene encodes a cysteine protease and member of the peptidase C15 family of proteins. The encoded protein cleaves amino terminal pyroglutamate residues from protein substrates including thyrotropin-releasing hormone and other neuropeptides. Expression of this gene may be downregulated in colorectal cancer, while activity of the encoded protein may be negatively correlated with cancer progression in colorectal cancer patients. Activity of the encoded protease may also be altered in other disease states including in liver cirrhosis, which is associated with reduced protease activity, and in necrozoospermia, which is associated with elevated protease activity. |
Molecular Mass : | 23 kDa |
AA Sequence : | MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PGPEP1 pyroglutamyl-peptidase I [ Homo sapiens (human) ] |
Official Symbol | PGPEP1 |
Synonyms | PGPEP1; pyroglutamyl-peptidase I; Pcp; PGP; PGP I; PGPI; PGP-I; |
Gene ID | 54858 |
mRNA Refseq | NM_017712 |
Protein Refseq | NP_060182 |
MIM | 610694 |
UniProt ID | Q9NXJ5 |
◆ Recombinant Proteins | ||
PGPEP1-4409R | Recombinant Rat PGPEP1 Protein | +Inquiry |
PGPEP1-6673M | Recombinant Mouse PGPEP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGPEP1-3212R | Recombinant Rhesus Macaque PGPEP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PGPEP1-2721Z | Recombinant Zebrafish PGPEP1 | +Inquiry |
PGPEP1-1008H | Recombinant Human PGPEP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGPEP1-1341HCL | Recombinant Human PGPEP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGPEP1 Products
Required fields are marked with *
My Review for All PGPEP1 Products
Required fields are marked with *
0
Inquiry Basket