Recombinant Human PGRMC1 protein, GST-tagged
| Cat.No. : | PGRMC1-1670H |
| Product Overview : | Recombinant Human PGRMC1 protein(43-195 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 30, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 43-195 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | YKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PGRMC1 progesterone receptor membrane component 1 [ Homo sapiens (human) ] |
| Official Symbol | PGRMC1 |
| Synonyms | PGRMC1; MPR; HPR6.6; progesterone receptor membrane component 1; membrane-associated progesterone receptor component 1; progesterone binding protein |
| Gene ID | 10857 |
| mRNA Refseq | NM_001282621 |
| Protein Refseq | NP_001269550 |
| MIM | 300435 |
| UniProt ID | O00264 |
| ◆ Recombinant Proteins | ||
| Pgrmc1-4829M | Recombinant Mouse Pgrmc1 Protein, Myc/DDK-tagged | +Inquiry |
| PGRMC1-1777Z | Recombinant Zebrafish PGRMC1 | +Inquiry |
| PGRMC1-4071R | Recombinant Rat PGRMC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PGRMC1-6674M | Recombinant Mouse PGRMC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PGRMC1-1666H | Recombinant Human PGRMC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PGRMC1-3248HCL | Recombinant Human PGRMC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PGRMC1 Products
Required fields are marked with *
My Review for All PGRMC1 Products
Required fields are marked with *
