Recombinant Human PHF13 protein, His-tagged
| Cat.No. : | PHF13-7854H |
| Product Overview : | Recombinant Human PHF13 protein(73-217 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 73-217 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | GFSDIASSVPLPVSDRCFSHLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDAPGKEGYRGGLLKLEAADPYVETPTSPTLQDIPQAPSDPCSGWDSDTPSSGSCATVSPDQVKEIKTEGKRTIVRQGKQVVFRDEDSTGN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | PHF13 |
| Synonyms | PHF13; PHD finger protein 13; MGC43399; PHD zinc finger protein PHF5; survival time-associated PHD protein in ovarian cancer; survival time-associated PHD finger protein in ovarian cancer 1; PHF5; SPOC1; |
| Gene ID | 148479 |
| mRNA Refseq | NM_153812 |
| Protein Refseq | NP_722519 |
| UniProt ID | Q86YI8 |
| ◆ Recombinant Proteins | ||
| PHF13-3845H | Recombinant Human PHF13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PHF13-1719H | Recombinant Human PHF13 | +Inquiry |
| PHF13-301146H | Recombinant Human PHF13 protein, GST-tagged | +Inquiry |
| PHF13-3223R | Recombinant Rhesus Macaque PHF13 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PHF13-6916Z | Recombinant Zebrafish PHF13 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PHF13-3236HCL | Recombinant Human PHF13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHF13 Products
Required fields are marked with *
My Review for All PHF13 Products
Required fields are marked with *
