Recombinant Human PHF17 protein, His-tagged
| Cat.No. : | PHF17-3348H |
| Product Overview : | Recombinant Human PHF17 protein(1-300 aa), fused to His tag, was expressed in E. coli. |
| Availability | August 18, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-300 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MKRGRLPSSSEDSDDNGSLSTTWSQNSRSQHRRSSCSRHEDRKPSEVFRTDLITAMKLHDSYQLNPDEYYVLADPWRQEWEKGVQVPVSPGTIPQPVARVVSEEKSLMFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGMPELDEYTMERVLEEFEQRCYDNMNHAIETEEGLGIEYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYGILKVPEGSWLCRTCALGVQPKCLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PHF17 PHD finger protein 17 [ Homo sapiens ] |
| Official Symbol | PHF17 |
| Synonyms | PHF17; PHD finger protein 17; protein Jade-1; JADE1; PHD protein Jade-1; gene for apoptosis and differentiation in epithelia; FLJ22479; KIAA1807; |
| Gene ID | 79960 |
| mRNA Refseq | NM_024900 |
| Protein Refseq | NP_079176 |
| MIM | 610514 |
| UniProt ID | Q6IE81 |
| ◆ Recombinant Proteins | ||
| PHF17-12722M | Recombinant Mouse PHF17 Protein | +Inquiry |
| PHF17-3406R | Recombinant Rhesus monkey PHF17 Protein, His-tagged | +Inquiry |
| PHF17-3348H | Recombinant Human PHF17 protein, His-tagged | +Inquiry |
| PHF17-3224R | Recombinant Rhesus Macaque PHF17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PHF17-6687M | Recombinant Mouse PHF17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PHF17-3233HCL | Recombinant Human PHF17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHF17 Products
Required fields are marked with *
My Review for All PHF17 Products
Required fields are marked with *



