Recombinant Human PHLDA2 Protein, His-tagged
Cat.No. : | PHLDA2-610H |
Product Overview : | Recombinant Human PHLDA2 fused with His tag at C-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 0.1M NaCl, 1mM DTT, pH 8.0 |
Molecular Mass : | 18.1kD |
AA Sequence : | MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTPLEHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | PHLDA2 pleckstrin homology-like domain, family A, member 2 [ Homo sapiens ] |
Official Symbol | PHLDA2 |
Synonyms | PHLDA2; pleckstrin homology-like domain, family A, member 2; TSSC3, tumor suppressing subtransferable candidate 3; pleckstrin homology-like domain family A member 2; BWR1C; HLDA2; IPL; p17-BWR1C; tumor-supressing STF cDNA 3; p17-Beckwith-Wiedemann region 1C; p17-Beckwith-Wiedemann region 1 C; tumor-suppressing STF cDNA 3 protein; imprinted in placenta and liver protein; tumor suppressing subtransferable candidate 3; tumor suppressing subchromosomal transferable fragment cDNA 3; beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein; tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein; BRW1C; TSSC3; |
Gene ID | 7262 |
mRNA Refseq | NM_003311 |
Protein Refseq | NP_003302 |
MIM | 602131 |
UniProt ID | Q53GA4 |
◆ Recombinant Proteins | ||
PHLDA2-12743M | Recombinant Mouse PHLDA2 Protein | +Inquiry |
PHLDA2-2776Z | Recombinant Zebrafish PHLDA2 | +Inquiry |
PHLDA2-610H | Recombinant Human PHLDA2 Protein, His-tagged | +Inquiry |
PHLDA2-5147H | Recombinant Human PHLDA2 Protein (Met1-Pro152), C-His tagged | +Inquiry |
Phlda2-599M | Recombinant Mouse Phlda2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHLDA2-3220HCL | Recombinant Human PHLDA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHLDA2 Products
Required fields are marked with *
My Review for All PHLDA2 Products
Required fields are marked with *
0
Inquiry Basket