Recombinant Human PHLPP1 protein, GST-tagged

Cat.No. : PHLPP1-107H
Product Overview : Recombinant Human PHLPP1 protein(NP_919431)(1068-1204 aa), fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1068-1204 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : QQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTP
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name PHLPP1 PH domain and leucine rich repeat protein phosphatase 1 [ Homo sapiens ]
Official Symbol PHLPP1
Synonyms PHLPP1; PH domain and leucine rich repeat protein phosphatase 1; PH domain and leucine rich repeat protein phosphatase , PHLPP, pleckstrin homology domain containing, family E (with leucine rich repeats) member 1 , PLEKHE1; PH domain leucine-rich repeat-containing protein phosphatase 1; KIAA0606; SCOP; SCN circadian oscillatory protein; PH domain-containing family E member 1; suprachiasmatic nucleus circadian oscillatory protein; pleckstrin homology domain containing, family E (with leucine rich repeats) member 1; PHLPP; PLEKHE1; MGC161555;
Gene ID 23239
mRNA Refseq NM_194449
Protein Refseq NP_919431
MIM 609396
UniProt ID O60346

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PHLPP1 Products

Required fields are marked with *

My Review for All PHLPP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon