Recombinant Human PHLPP1 protein, GST-tagged
Cat.No. : | PHLPP1-107H |
Product Overview : | Recombinant Human PHLPP1 protein(NP_919431)(1068-1204 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1068-1204 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | QQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | PHLPP1 PH domain and leucine rich repeat protein phosphatase 1 [ Homo sapiens ] |
Official Symbol | PHLPP1 |
Synonyms | PHLPP1; PH domain and leucine rich repeat protein phosphatase 1; PH domain and leucine rich repeat protein phosphatase , PHLPP, pleckstrin homology domain containing, family E (with leucine rich repeats) member 1 , PLEKHE1; PH domain leucine-rich repeat-containing protein phosphatase 1; KIAA0606; SCOP; SCN circadian oscillatory protein; PH domain-containing family E member 1; suprachiasmatic nucleus circadian oscillatory protein; pleckstrin homology domain containing, family E (with leucine rich repeats) member 1; PHLPP; PLEKHE1; MGC161555; |
Gene ID | 23239 |
mRNA Refseq | NM_194449 |
Protein Refseq | NP_919431 |
MIM | 609396 |
UniProt ID | O60346 |
◆ Recombinant Proteins | ||
PHLPP1-934H | Recombinant Human PHLPP1 | +Inquiry |
PHLPP1-107H | Recombinant Human PHLPP1 protein, GST-tagged | +Inquiry |
Phlpp1-4842M | Recombinant Mouse Phlpp1 Protein, Myc/DDK-tagged | +Inquiry |
PHLPP1-6707M | Recombinant Mouse PHLPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PHLPP1-5157H | Recombinant Human PHLPP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHLPP1-3218HCL | Recombinant Human PHLPP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHLPP1 Products
Required fields are marked with *
My Review for All PHLPP1 Products
Required fields are marked with *
0
Inquiry Basket