Recombinant Human PHOSPHO2, His-tagged
Cat.No. : | PHOSPHO2-29980TH |
Product Overview : | Recombinant full length Human PHOSPHO2 with N terminal His tag; 265 amino acids with tag, Predicted MWt 30.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 241 amino acids |
Description : | Pyridoxal phosphate phosphatase PHOSPHO2, orphan 2, also known as PHOSPHO2, belongs to the haloacid dehalogenase(HAD) superfamily. Phosphatase has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). |
Conjugation : | HIS |
Molecular Weight : | 30.300kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMKILLVFDFDNTIIDD NSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLG DKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCII ISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTV ENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVY IGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLE PMEYSVVVWSSGVDIISHLQFLIKD |
Sequence Similarities : | Belongs to the HAD-like hydrolase superfamily. PHOSPHO family. |
Gene Name | PHOSPHO2 phosphatase, orphan 2 [ Homo sapiens ] |
Official Symbol | PHOSPHO2 |
Synonyms | PHOSPHO2; phosphatase, orphan 2; pyridoxal phosphate phosphatase PHOSPHO2; MGC22679; |
Gene ID | 493911 |
mRNA Refseq | NM_001199286 |
Protein Refseq | NP_001186215 |
Uniprot ID | Q8TCD6 |
Chromosome Location | 2q31.1 |
Pathway | Metabolic pathways, organism-specific biosystem; Vitamin B6 metabolism, organism-specific biosystem; Vitamin B6 metabolism, conserved biosystem; |
Function | hydrolase activity; metal ion binding; pyridoxal phosphatase activity; |
◆ Recombinant Proteins | ||
PHOSPHO2-4090R | Recombinant Rat PHOSPHO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PHOSPHO2-3413R | Recombinant Rhesus monkey PHOSPHO2 Protein, His-tagged | +Inquiry |
PHOSPHO2-3231R | Recombinant Rhesus Macaque PHOSPHO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PHOSPHO2-6264Z | Recombinant Zebrafish PHOSPHO2 | +Inquiry |
PHOSPHO2-1574H | Recombinant Human Phosphatase, Orphan 2, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHOSPHO2 Products
Required fields are marked with *
My Review for All PHOSPHO2 Products
Required fields are marked with *