Recombinant Human PHOSPHO2, His-tagged
| Cat.No. : | PHOSPHO2-29980TH | 
| Product Overview : | Recombinant full length Human PHOSPHO2 with N terminal His tag; 265 amino acids with tag, Predicted MWt 30.3 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 241 amino acids | 
| Description : | Pyridoxal phosphate phosphatase PHOSPHO2, orphan 2, also known as PHOSPHO2, belongs to the haloacid dehalogenase(HAD) superfamily. Phosphatase has a high activity toward phosphoethanolamine (PEA) and phosphocholine (PCho). | 
| Conjugation : | HIS | 
| Molecular Weight : | 30.300kDa inclusive of tags | 
| Form : | Liquid | 
| Purity : | by SDS-PAGE | 
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride | 
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. | 
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMKILLVFDFDNTIIDD NSDTWIVQCAPNKKLPIELRDSYRKGFWTEFMGRVFKYLG DKGVREHEMKRAVTSLPFTPGMVELFNFIRKNKDKFDCII ISDSNSVFIDWVLEAASFHDIFDKVFTNPAAFNSNGHLTV ENYHTHSCNRCPKNLCKKVVLIEFVDKQLQQGVNYTQIVY IGDGGNDVCPVTFLKNDDVAMPRKGYTLQKTLSRMSQNLE PMEYSVVVWSSGVDIISHLQFLIKD | 
| Sequence Similarities : | Belongs to the HAD-like hydrolase superfamily. PHOSPHO family. | 
| Gene Name | PHOSPHO2 phosphatase, orphan 2 [ Homo sapiens ] | 
| Official Symbol | PHOSPHO2 | 
| Synonyms | PHOSPHO2; phosphatase, orphan 2; pyridoxal phosphate phosphatase PHOSPHO2; MGC22679; | 
| Gene ID | 493911 | 
| mRNA Refseq | NM_001199286 | 
| Protein Refseq | NP_001186215 | 
| Uniprot ID | Q8TCD6 | 
| Chromosome Location | 2q31.1 | 
| Pathway | Metabolic pathways, organism-specific biosystem; Vitamin B6 metabolism, organism-specific biosystem; Vitamin B6 metabolism, conserved biosystem; | 
| Function | hydrolase activity; metal ion binding; pyridoxal phosphatase activity; | 
| ◆ Recombinant Proteins | ||
| PHOSPHO2-29980TH | Recombinant Human PHOSPHO2, His-tagged | +Inquiry | 
| PHOSPHO2-4090R | Recombinant Rat PHOSPHO2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| PHOSPHO2-4430R | Recombinant Rat PHOSPHO2 Protein | +Inquiry | 
| PHOSPHO2-6708M | Recombinant Mouse PHOSPHO2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| PHOSPHO2-1574H | Recombinant Human Phosphatase, Orphan 2, His-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHOSPHO2 Products
Required fields are marked with *
My Review for All PHOSPHO2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            