Recombinant Human PHYH protein, GST-tagged
Cat.No. : | PHYH-3339H |
Product Overview : | Recombinant Human PHYH protein(O14832)(1-338aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-338aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 62.4 kDa |
AA Sequence : | SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PHYH phytanoyl-CoA 2-hydroxylase [ Homo sapiens ] |
Official Symbol | PHYH |
Synonyms | PHYH; phytanoyl-CoA 2-hydroxylase; phytanoyl CoA hydroxylase , phytanoyl CoA hydroxylase (Refsum disease); phytanoyl-CoA dioxygenase, peroxisomal; PAHX; PHYH1; phytanoyl CoA dioxygenase; RD; Refsum disease; phytanic acid oxidase; phytanoil-CoA alpha hydroxylase; phytanoyl-CoA alpha-hydroxylase; phytanoyl-CoA 2 oxoglutarate dioxygenase; LN1; LNAP1; |
Gene ID | 5264 |
mRNA Refseq | NM_001037537 |
Protein Refseq | NP_001032626 |
MIM | 602026 |
UniProt ID | O14832 |
◆ Recombinant Proteins | ||
PHYH-8581H | Recombinant Human PHYH protein(Ser31-Leu338) | +Inquiry |
PHYH-2553Z | Recombinant Zebrafish PHYH | +Inquiry |
Phyh-1331M | Recombinant Mouse Phyh Protein, MYC/DDK-tagged | +Inquiry |
PHYH-12757M | Recombinant Mouse PHYH Protein | +Inquiry |
PHYH-3396H | Recombinant Human PHYH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHYH-3214HCL | Recombinant Human PHYH 293 Cell Lysate | +Inquiry |
PHYH-3213HCL | Recombinant Human PHYH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PHYH Products
Required fields are marked with *
My Review for All PHYH Products
Required fields are marked with *
0
Inquiry Basket