Recombinant Human PHYH protein, GST-tagged

Cat.No. : PHYH-3339H
Product Overview : Recombinant Human PHYH protein(O14832)(1-338aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-338aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 62.4 kDa
AA Sequence : SGTISSASFHPQQFQYTLDNNVLTLEQRKFYEENGFLVIKNLVPDADIQRFRNEFEKICRKEVKPLGLTVMRDVTISKSEYAPSEKMITKVQDFQEDKELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFRPSDLIVCAWTAMEHISRNNGCLVVLPGTHKGSLKPHDYPKWEGGVNKMFHGIQDYEENKARVHLVMEKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENIEKEVVGIAHKFFGAENSVNLKDIWMFRARLVKGERTNL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name PHYH phytanoyl-CoA 2-hydroxylase [ Homo sapiens ]
Official Symbol PHYH
Synonyms PHYH; phytanoyl-CoA 2-hydroxylase; phytanoyl CoA hydroxylase , phytanoyl CoA hydroxylase (Refsum disease); phytanoyl-CoA dioxygenase, peroxisomal; PAHX; PHYH1; phytanoyl CoA dioxygenase; RD; Refsum disease; phytanic acid oxidase; phytanoil-CoA alpha hydroxylase; phytanoyl-CoA alpha-hydroxylase; phytanoyl-CoA 2 oxoglutarate dioxygenase; LN1; LNAP1;
Gene ID 5264
mRNA Refseq NM_001037537
Protein Refseq NP_001032626
MIM 602026
UniProt ID O14832

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PHYH Products

Required fields are marked with *

My Review for All PHYH Products

Required fields are marked with *

0
cart-icon