Recombinant Human PHYKPL Protein, GST-tagged
Cat.No. : | PHYKPL-4351H |
Product Overview : | Human MGC15875 full-length ORF ( ENSP00000321290, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This is a nuclear gene encoding a mitochondrial enzyme that catalyzes the conversion of 5-phosphonooxy-L-lysine to ammonia, inorganic phosphate, and 2-aminoadipate semialdehyde. Mutations in this gene may cause phosphohydroxylysinuria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
Molecular Mass : | 45.3 kDa |
AA Sequence : | MGKSIGNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETLRLQP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PHYKPL 5-phosphohydroxy-L-lysine phospho-lyase [ Homo sapiens (human) ] |
Official Symbol | PHYKPL |
Synonyms | PHYKPL; 5-phosphohydroxy-L-lysine phospho-lyase; PHLU; AGXT2L2 |
Gene ID | 85007 |
mRNA Refseq | NM_153373 |
Protein Refseq | NP_699204 |
MIM | 614683 |
UniProt ID | Q8IUZ5 |
◆ Recombinant Proteins | ||
Phykpl-4847M | Recombinant Mouse Phykpl Protein, Myc/DDK-tagged | +Inquiry |
PHYKPL-4351H | Recombinant Human PHYKPL Protein, GST-tagged | +Inquiry |
PHYKPL-6146HF | Recombinant Full Length Human PHYKPL Protein, GST-tagged | +Inquiry |
PHYKPL-721H | Recombinant Human PHYKPL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PHYKPL-3548Z | Recombinant Zebrafish PHYKPL | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHYKPL Products
Required fields are marked with *
My Review for All PHYKPL Products
Required fields are marked with *