Recombinant Human PHYKPL Protein, GST-tagged

Cat.No. : PHYKPL-4351H
Product Overview : Human MGC15875 full-length ORF ( ENSP00000321290, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This is a nuclear gene encoding a mitochondrial enzyme that catalyzes the conversion of 5-phosphonooxy-L-lysine to ammonia, inorganic phosphate, and 2-aminoadipate semialdehyde. Mutations in this gene may cause phosphohydroxylysinuria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
Molecular Mass : 45.3 kDa
AA Sequence : MGKSIGNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETLRLQP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PHYKPL 5-phosphohydroxy-L-lysine phospho-lyase [ Homo sapiens (human) ]
Official Symbol PHYKPL
Synonyms PHYKPL; 5-phosphohydroxy-L-lysine phospho-lyase; PHLU; AGXT2L2
Gene ID 85007
mRNA Refseq NM_153373
Protein Refseq NP_699204
MIM 614683
UniProt ID Q8IUZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PHYKPL Products

Required fields are marked with *

My Review for All PHYKPL Products

Required fields are marked with *

0
cart-icon
0
compare icon