Recombinant Human PI15 protein, His-tagged
| Cat.No. : | PI15-1697H |
| Product Overview : | Recombinant Human PI15 protein(1-256 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-256 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MIAISAVSSALLFSLLCEASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYLLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGVPCSSCPPSYGGSCTDNLCFPGVTSNYLYW |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PI15 peptidase inhibitor 15 [ Homo sapiens ] |
| Official Symbol | PI15 |
| Synonyms | PI15; peptidase inhibitor 15; protease inhibitor 15; P25TI; PI-15; CRISP-8; sugarCrisp; 25 kDa trypsin inhibitor; cysteine-rich secretory protein 8; P24TI; CRISP8; DKFZp686F0366; |
| Gene ID | 51050 |
| mRNA Refseq | NM_015886 |
| Protein Refseq | NP_056970 |
| MIM | 607076 |
| UniProt ID | O43692 |
| ◆ Recombinant Proteins | ||
| PI15-5906C | Recombinant Chicken PI15 | +Inquiry |
| PI15-3235R | Recombinant Rhesus Macaque PI15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PI15-12761M | Recombinant Mouse PI15 Protein | +Inquiry |
| PI15-2588H | Recombinant Human PI15 Protein, His-tagged | +Inquiry |
| PI15-6713M | Recombinant Mouse PI15 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PI15-3209HCL | Recombinant Human PI15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PI15 Products
Required fields are marked with *
My Review for All PI15 Products
Required fields are marked with *
