Recombinant Human PI3 Protein, His-tagged
Cat.No. : | PI3-212H |
Product Overview : | Recombinant Human PI3 fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. |
Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5 |
Molecular Mass : | 11kD |
AA Sequence : | AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Gene Name | PI3 peptidase inhibitor 3, skin-derived [ Homo sapiens ] |
Official Symbol | PI3 |
Synonyms | PI3; peptidase inhibitor 3, skin-derived; protease inhibitor 3, skin derived (SKALP); elafin; cementoin; ELAFIN; ESI; SKALP; skin derived antileukoproteinase; trappin 2; WAP3; WFDC14; PI-3; trappin-2; pre-elafin; protease inhibitor WAP3; elastase-specific inhibitor; skin-derived antileukoproteinase; WAP four-disulfide core domain 14; WAP four-disulfide core domain protein 14; protease inhibitor 3, skin-derived (SKALP); MGC13613; |
Gene ID | 5266 |
mRNA Refseq | NM_002638 |
Protein Refseq | NP_002629 |
MIM | 182257 |
UniProt ID | P19957 |
◆ Recombinant Proteins | ||
PI3-3237R | Recombinant Rhesus Macaque PI3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PI3-5494H | Recombinant Human PI3 protein, His-tagged | +Inquiry |
PI3-01H | Recombinant Human PI3 protein, His-tagged | +Inquiry |
PI3-02H | Recombinant Human PI3 protein, His-tagged | +Inquiry |
PI3-15888H | Recombinant Human PI3 , His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PI3-2035HCL | Recombinant Human PI3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PI3 Products
Required fields are marked with *
My Review for All PI3 Products
Required fields are marked with *