Recombinant Human PI3 Protein, His-tagged
| Cat.No. : | PI3-212H |
| Product Overview : | Recombinant Human PI3 fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Description : | This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines. |
| Form : | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5 |
| Molecular Mass : | 11kD |
| AA Sequence : | AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHH |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | PI3 peptidase inhibitor 3, skin-derived [ Homo sapiens ] |
| Official Symbol | PI3 |
| Synonyms | PI3; peptidase inhibitor 3, skin-derived; protease inhibitor 3, skin derived (SKALP); elafin; cementoin; ELAFIN; ESI; SKALP; skin derived antileukoproteinase; trappin 2; WAP3; WFDC14; PI-3; trappin-2; pre-elafin; protease inhibitor WAP3; elastase-specific inhibitor; skin-derived antileukoproteinase; WAP four-disulfide core domain 14; WAP four-disulfide core domain protein 14; protease inhibitor 3, skin-derived (SKALP); MGC13613; |
| Gene ID | 5266 |
| mRNA Refseq | NM_002638 |
| Protein Refseq | NP_002629 |
| MIM | 182257 |
| UniProt ID | P19957 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PI3 Products
Required fields are marked with *
My Review for All PI3 Products
Required fields are marked with *
