"PI3" Related Products

Expand

Recombinant Human PI3 Protein, His-tagged

Cat.No. : PI3-212H
Product Overview : Recombinant Human PI3 fused with His tag at C-terminal was expressed in HEK293 cells.
Description : This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.
Source : HEK293 cells
Tag : His
Form : Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 7.5
Molecular Mass : 11kD
AA Sequence : AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHH
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name : PI3 peptidase inhibitor 3, skin-derived [ Homo sapiens ]
Official Symbol : PI3
Synonyms : PI3; peptidase inhibitor 3, skin-derived; protease inhibitor 3, skin derived (SKALP); elafin; cementoin; ELAFIN; ESI; SKALP; skin derived antileukoproteinase; trappin 2; WAP3; WFDC14; PI-3; trappin-2; pre-elafin; protease inhibitor WAP3; elastase-specific inhibitor; skin-derived antileukoproteinase; WAP four-disulfide core domain 14; WAP four-disulfide core domain protein 14; protease inhibitor 3, skin-derived (SKALP); MGC13613;
Gene ID : 5266
mRNA Refseq : NM_002638
Protein Refseq : NP_002629
MIM : 182257
UniProt ID : P19957

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.