Recombinant Human PIP protein, His-tagged
| Cat.No. : | PIP-3341H |
| Product Overview : | Recombinant Human PIP protein(P12273)(29-146aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 29-146aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.5 kDa |
| AA Sequence : | QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PIP prolactin-induced protein [ Homo sapiens ] |
| Official Symbol | PIP |
| Synonyms | PIP; prolactin-induced protein; prolactin-inducible protein; GCDFP 15; GCDFP15; GPIP4; prolactin inducible protein; SABP; secretory actin-binding protein; gross cystic disease fluid protein 15; GCDFP-15; |
| Gene ID | 5304 |
| mRNA Refseq | NM_002652 |
| Protein Refseq | NP_002643 |
| MIM | 176720 |
| UniProt ID | P12273 |
| ◆ Recombinant Proteins | ||
| Pip-1925M | Recombinant Mouse Pip protein, His & GST-tagged | +Inquiry |
| pip-3724M | Recombinant Mycoplasma pneumoniae pip protein, His-SUMO-tagged | +Inquiry |
| PIP-12824M | Recombinant Mouse PIP Protein | +Inquiry |
| PIP-6752M | Recombinant Mouse PIP Protein, His (Fc)-Avi-tagged | +Inquiry |
| PIP-213H | Recombinant Human PIP Protein, DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PIP-17HFL | Native Full Length Human Prolactin inducible protein | +Inquiry |
| PIP-20H | Native Human PIP Protein (118 aa) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PIP-3176HCL | Recombinant Human PIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIP Products
Required fields are marked with *
My Review for All PIP Products
Required fields are marked with *
