Recombinant Human PIR Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PIR-6297H |
Product Overview : | PIR MS Standard C13 and N15-labeled recombinant protein (NP_001018119) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the cupin superfamily. The encoded protein is an Fe(II)-containing nuclear protein expressed in all tissues of the body and concentrated within dot-like subnuclear structures. Interactions with nuclear factor I/CCAAT box transcription factor as well as B cell lymphoma 3-encoded oncoprotein suggest the encoded protein may act as a transcriptional cofactor and be involved in the regulation of DNA transcription and replication. Alternatively spliced transcript variants have been described. |
Molecular Mass : | 32.1 kDa |
AA Sequence : | MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVLIAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PIR pirin [ Homo sapiens (human) ] |
Official Symbol | PIR |
Synonyms | PIR; pirin (iron-binding nuclear protein); pirin; probable quercetinase; probable quercetin 2,3-dioxygenase PIR; |
Gene ID | 8544 |
mRNA Refseq | NM_001018109 |
Protein Refseq | NP_001018119 |
MIM | 603329 |
UniProt ID | O00625 |
◆ Recombinant Proteins | ||
PIR-4472R | Recombinant Rat PIR Protein | +Inquiry |
PIR-671Z | Recombinant Zebrafish PIR | +Inquiry |
PIR-5547H | Recombinant Human Pirin (iron-binding nuclear protein), His-tagged | +Inquiry |
PIR-453H | Recombinant Human PIR Protein, His-tagged | +Inquiry |
PIR-3439R | Recombinant Rhesus monkey PIR Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIR-3168HCL | Recombinant Human PIR 293 Cell Lysate | +Inquiry |
PIR-3169HCL | Recombinant Human PIR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PIR Products
Required fields are marked with *
My Review for All PIR Products
Required fields are marked with *
0
Inquiry Basket