Recombinant Human PKIB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PKIB-600H |
Product Overview : | PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861459) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role in prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Molecular Mass : | 8.5 kDa |
AA Sequence : | MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PKIB cAMP-dependent protein kinase inhibitor beta [ Homo sapiens (human) ] |
Official Symbol | PKIB |
Synonyms | PKIB; protein kinase (cAMP-dependent, catalytic) inhibitor beta; PRKACN2; cAMP-dependent protein kinase inhibitor beta; PKI-beta; cAMP-dependent protein kinase inhibitor 2; FLJ23817; |
Gene ID | 5570 |
mRNA Refseq | NM_181794 |
Protein Refseq | NP_861459 |
MIM | 606914 |
UniProt ID | Q9C010 |
◆ Recombinant Proteins | ||
PKIB-5630C | Recombinant Chicken PKIB | +Inquiry |
PKIB-3448R | Recombinant Rhesus monkey PKIB Protein, His-tagged | +Inquiry |
Pkib-1941R | Recombinant Rat Pkib Protein, His&GST-tagged | +Inquiry |
Pkib-4886M | Recombinant Mouse Pkib Protein, Myc/DDK-tagged | +Inquiry |
PKIB-972H | Recombinant Human cAMP-Dependent Protein Kinase Inhibitor Beta, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKIB-3157HCL | Recombinant Human PKIB 293 Cell Lysate | +Inquiry |
PKIB-3156HCL | Recombinant Human PKIB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PKIB Products
Required fields are marked with *
My Review for All PKIB Products
Required fields are marked with *