Recombinant Human PKIB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PKIB-600H
• Product Overview: PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861459) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role in prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Molecular Mass: 8.5 kDa
• AA Sequence: MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PKIB cAMP-dependent protein kinase inhibitor beta [ Homo sapiens (human) ]
• Official Symbol: PKIB
• Synonyms: PKIB; protein kinase (cAMP-dependent, catalytic) inhibitor beta; PRKACN2; cAMP-dependent protein kinase inhibitor beta; PKI-beta; cAMP-dependent protein kinase inhibitor 2; FLJ23817
• Gene ID: 5570
• mRNA Refseq: NM_181794
• Protein Refseq: NP_861459
• MIM: 606914
• UniProt ID: Q9C010