Recombinant Human PKIB Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PKIB-600H |
| Product Overview : | PKIB MS Standard C13 and N15-labeled recombinant protein (NP_861459) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the cAMP-dependent protein kinase inhibitor family. The encoded protein may play a role in the protein kinase A (PKA) pathway by interacting with the catalytic subunit of PKA, and overexpression of this gene may play a role in prostate cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Molecular Mass : | 8.5 kDa |
| AA Sequence : | MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PKIB cAMP-dependent protein kinase inhibitor beta [ Homo sapiens (human) ] |
| Official Symbol | PKIB |
| Synonyms | PKIB; protein kinase (cAMP-dependent, catalytic) inhibitor beta; PRKACN2; cAMP-dependent protein kinase inhibitor beta; PKI-beta; cAMP-dependent protein kinase inhibitor 2; FLJ23817; |
| Gene ID | 5570 |
| mRNA Refseq | NM_181794 |
| Protein Refseq | NP_861459 |
| MIM | 606914 |
| UniProt ID | Q9C010 |
| ◆ Recombinant Proteins | ||
| PKIB-3448R | Recombinant Rhesus monkey PKIB Protein, His-tagged | +Inquiry |
| PKIB-972H | Recombinant Human cAMP-Dependent Protein Kinase Inhibitor Beta, His-tagged | +Inquiry |
| PKIB-6609Z | Recombinant Zebrafish PKIB | +Inquiry |
| Pkib-4886M | Recombinant Mouse Pkib Protein, Myc/DDK-tagged | +Inquiry |
| PKIB-656H | Recombinant Human PKIB Protein, GST-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PKIB-3156HCL | Recombinant Human PKIB 293 Cell Lysate | +Inquiry |
| PKIB-3157HCL | Recombinant Human PKIB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PKIB Products
Required fields are marked with *
My Review for All PKIB Products
Required fields are marked with *



