Recombinant Human PLA2R1 protein, His-tagged
| Cat.No. : | PLA2R1-4435H |
| Product Overview : | Recombinant Human PLA2R1 protein(Q13018)(395-530aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 395-530aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.4 kDa |
| AA Sequence : | EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PLA2R1 phospholipase A2 receptor 1, 180kDa [ Homo sapiens ] |
| Official Symbol | PLA2R1 |
| Synonyms | PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R |
| Gene ID | 22925 |
| mRNA Refseq | NM_007366.4 |
| Protein Refseq | NP_031392.3 |
| MIM | 604939 |
| UniProt ID | Q13018 |
| ◆ Recombinant Proteins | ||
| PLA2R1-1661H | Recombinant Human PLA2R1 Protein (395-530 aa), His-tagged | +Inquiry |
| PLA2R1-1874H | Recombinant Human PLA2R1 Protein, MYC/DDK-tagged | +Inquiry |
| PLA2R1-6805M | Recombinant Mouse PLA2R1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Pla2r1-10608M | Recombinant Mouse Pla2r1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLA2R1-1026H | Recombinant Human PLA2R1 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2R1 Products
Required fields are marked with *
My Review for All PLA2R1 Products
Required fields are marked with *
