Recombinant Human PLAC9 protein, His-tagged
Cat.No. : | PLAC9-453H |
Product Overview : | Recombinant Human PLAC9 protein(Q5JTB6)(23-97aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-97aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AEPFSPPRGDSAQSTACDRHMAVQRRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDGF |
Gene Name | PLAC9 placenta-specific 9 [ Homo sapiens ] |
Official Symbol | PLAC9 |
Gene ID | 219348 |
mRNA Refseq | NM_001012973.1 |
Protein Refseq | NP_001012991.1 |
MIM | 612857 |
UniProt ID | Q5JTB6 |
◆ Recombinant Proteins | ||
PLAC9-248H | Recombinant Human PLAC9, Fc tagged | +Inquiry |
PLAC9-3459R | Recombinant Rhesus monkey PLAC9 Protein, His-tagged | +Inquiry |
PLAC9-4103H | Recombinant Human PLAC9 Protein (Ala23-Phe97), N-GST tagged | +Inquiry |
PLAC9-1761H | Recombinant Human PLAC9 protein, GST-tagged | +Inquiry |
PLAC9-2594H | Recombinant Human PLAC9 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAC9-921HCL | Recombinant Human PLAC9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAC9 Products
Required fields are marked with *
My Review for All PLAC9 Products
Required fields are marked with *