Recombinant Human PLCD4 protein, His-tagged
Cat.No. : | PLCD4-3655H |
Product Overview : | Recombinant Human PLCD4 protein(462-762 aa), fused to His tag, was expressed in E. coli. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 462-762 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ESQFETEPEPQEQNLQNKDKKKKSKPILCPALSSLVIYLKSVSFRSFTHSKEHYHFYEISSFSETKAKRLIKEAGNEFVQHNTWQLSRVYPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCGYVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKEGSIVDPLVKVQIFGVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLRFVVMDYDWKSRNDFIGQYTLPWTCMQQGYRHIHLLSKDGISLRPASIFVYICIQEGLEGDES |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PLCD4 phospholipase C, delta 4 [ Homo sapiens ] |
Official Symbol | PLCD4 |
Synonyms | PLCD4; phospholipase C, delta 4; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4; PLC delta4; phosphoinositide phospholipase C-delta-4; MGC12837; |
Gene ID | 84812 |
mRNA Refseq | NM_032726 |
Protein Refseq | NP_116115 |
MIM | 605939 |
UniProt ID | Q9BRC7 |
◆ Recombinant Proteins | ||
PLCD4-2183H | Recombinant Human PLCD4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PLCD4-3655H | Recombinant Human PLCD4 protein, His-tagged | +Inquiry |
PLCD4-8268H | Recombinant Human PLCD4 protein, His & T7-tagged | +Inquiry |
PLCD4-4503R | Recombinant Rat PLCD4 Protein | +Inquiry |
PLCD4-12922M | Recombinant Mouse PLCD4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLCD4-3128HCL | Recombinant Human PLCD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLCD4 Products
Required fields are marked with *
My Review for All PLCD4 Products
Required fields are marked with *