Recombinant Human PLEK
Cat.No. : | PLEK-28515TH |
Product Overview : | Recombinant fragment of Human Pleckstrin with N terminal proprietary tag. Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Pleckstrin is a protein found in platelets. The name derives from platelet and leukocyte C kinase substrate and the KSTR string of amino acids. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNC VIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSA VDGTAENPFLDNPDAFYYFPDSGFFCEENS |
Sequence Similarities : | Contains 1 DEP domain.Contains 2 PH domains. |
Gene Name : | PLEK pleckstrin [ Homo sapiens ] |
Official Symbol : | PLEK |
Synonyms : | PLEK; pleckstrin; P47; |
Gene ID : | 5341 |
mRNA Refseq : | NM_002664 |
Protein Refseq : | NP_002655 |
MIM : | 173570 |
Uniprot ID : | P08567 |
Chromosome Location : | 2p13.3 |
Pathway : | Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem; |
Function : | phosphatidylinositol-3,4-bisphosphate binding; protein binding; protein homodimerization activity; protein kinase C binding; |
Products Types
◆ Recombinant Protein | ||
Plek-4923M | Recombinant Mouse Plek Protein, Myc/DDK-tagged | +Inquiry |
PLEK-4172R | Recombinant Rat PLEK Protein, His (Fc)-Avi-tagged | +Inquiry |
PLEK-1773H | Recombinant Human PLEK, His-tagged | +Inquiry |
PLEK-11094Z | Recombinant Zebrafish PLEK | +Inquiry |
PLEK-497H | Recombinant Human PLEK, His tagged | +Inquiry |
◆ Lysates | ||
PLEK-3119HCL | Recombinant Human PLEK 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket