Recombinant Human PLEK

• Cat.No.: PLEK-28515TH
• Product Overview: Recombinant fragment of Human Pleckstrin with N terminal proprietary tag. Predicted MW 37.73 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: Pleckstrin is a protein found in platelets. The name derives from platelet and leukocyte C kinase substrate and the KSTR string of amino acids.
• Molecular Weight: 37.730kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNC VIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSA VDGTAENPFLDNPDAFYYFPDSGFFCEENS
• Sequence Similarities: Contains 1 DEP domain.Contains 2 PH domains.

Gene Information

• Gene Name: PLEK pleckstrin [ Homo sapiens ]
• Official Symbol: PLEK
• Synonyms: PLEK; pleckstrin; P47
• Gene ID: 5341
• mRNA Refseq: NM_002664
• Protein Refseq: NP_002655
• MIM: 173570
• Uniprot ID: P08567
• Chromosome Location: 2p13.3
• Pathway: Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem
• Function: phosphatidylinositol-3,4-bisphosphate binding; protein binding; protein homodimerization activity; protein kinase C binding