Recombinant Human PLEK

Cat.No. : PLEK-28515TH
Product Overview : Recombinant fragment of Human Pleckstrin with N terminal proprietary tag. Predicted MW 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : Pleckstrin is a protein found in platelets. The name derives from platelet and leukocyte C kinase substrate and the KSTR string of amino acids.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNC VIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSA VDGTAENPFLDNPDAFYYFPDSGFFCEENS
Sequence Similarities : Contains 1 DEP domain.Contains 2 PH domains.
Gene Name PLEK pleckstrin [ Homo sapiens ]
Official Symbol PLEK
Synonyms PLEK; pleckstrin; P47;
Gene ID 5341
mRNA Refseq NM_002664
Protein Refseq NP_002655
MIM 173570
Uniprot ID P08567
Chromosome Location 2p13.3
Pathway Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem;
Function phosphatidylinositol-3,4-bisphosphate binding; protein binding; protein homodimerization activity; protein kinase C binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLEK Products

Required fields are marked with *

My Review for All PLEK Products

Required fields are marked with *

0
cart-icon