Recombinant Human PLEK
Cat.No. : | PLEK-28515TH |
Product Overview : | Recombinant fragment of Human Pleckstrin with N terminal proprietary tag. Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Pleckstrin is a protein found in platelets. The name derives from platelet and leukocyte C kinase substrate and the KSTR string of amino acids. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNC VIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSA VDGTAENPFLDNPDAFYYFPDSGFFCEENS |
Sequence Similarities : | Contains 1 DEP domain.Contains 2 PH domains. |
Gene Name | PLEK pleckstrin [ Homo sapiens ] |
Official Symbol | PLEK |
Synonyms | PLEK; pleckstrin; P47; |
Gene ID | 5341 |
mRNA Refseq | NM_002664 |
Protein Refseq | NP_002655 |
MIM | 173570 |
Uniprot ID | P08567 |
Chromosome Location | 2p13.3 |
Pathway | Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem; |
Function | phosphatidylinositol-3,4-bisphosphate binding; protein binding; protein homodimerization activity; protein kinase C binding; |
◆ Recombinant Proteins | ||
PLEK-4172R | Recombinant Rat PLEK Protein, His (Fc)-Avi-tagged | +Inquiry |
PLEK-497H | Recombinant Human PLEK, His tagged | +Inquiry |
PLEK-4512R | Recombinant Rat PLEK Protein | +Inquiry |
PLEK-11094Z | Recombinant Zebrafish PLEK | +Inquiry |
PLEK-30882TH | Recombinant Human PLEK | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLEK-3119HCL | Recombinant Human PLEK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLEK Products
Required fields are marked with *
My Review for All PLEK Products
Required fields are marked with *