Recombinant Human PLEKHA1 protein, His-tagged

• Cat.No.: PLEKHA1-3187H
• Product Overview: Recombinant Human PLEKHA1 protein(119-196 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 119-196 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: SDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQDSAVIKAG
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: PLEKHA1 pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 [ Homo sapiens ]
• Official Symbol: PLEKHA1
• Synonyms: PLEKHA1; pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1; pleckstrin homology domain-containing family A member 1; tandem PH domain containing protein 1; TAPP1; tandem PH domain-containing protein 1
• Gene ID: 59338
• mRNA Refseq: NM_001001974
• Protein Refseq: NP_001001974
• MIM: 607772
• UniProt ID: Q9HB21