Recombinant Human PLEKHA1 protein, His-tagged
| Cat.No. : | PLEKHA1-3187H |
| Product Overview : | Recombinant Human PLEKHA1 protein(119-196 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 119-196 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQDSAVIKAG |
| Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PLEKHA1 pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 [ Homo sapiens ] |
| Official Symbol | PLEKHA1 |
| Synonyms | PLEKHA1; pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1; pleckstrin homology domain-containing family A member 1; tandem PH domain containing protein 1; TAPP1; tandem PH domain-containing protein 1; |
| Gene ID | 59338 |
| mRNA Refseq | NM_001001974 |
| Protein Refseq | NP_001001974 |
| MIM | 607772 |
| UniProt ID | Q9HB21 |
| ◆ Recombinant Proteins | ||
| PLEKHA1-2108H | Recombinant Human PLEKHA1 Protein, MYC/DDK-tagged | +Inquiry |
| PLEKHA1-1775H | Recombinant Human PLEKHA1 protein, GST-tagged | +Inquiry |
| Plekha1-182M | Recombinant Mouse Plekha1 Protein, MYC/DDK-tagged | +Inquiry |
| PLEKHA1-6827M | Recombinant Mouse PLEKHA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PLEKHA1-12607Z | Recombinant Zebrafish PLEKHA1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PLEKHA1-1372HCL | Recombinant Human PLEKHA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLEKHA1 Products
Required fields are marked with *
My Review for All PLEKHA1 Products
Required fields are marked with *
