Recombinant Human PLEKHA1 protein, His-tagged
Cat.No. : | PLEKHA1-3187H |
Product Overview : | Recombinant Human PLEKHA1 protein(119-196 aa), fused to His tag, was expressed in E. coli. |
Availability | July 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 119-196 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SDSQPNSDNLSRHGECGKKQVSYRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQDSAVIKAG |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PLEKHA1 pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 [ Homo sapiens ] |
Official Symbol | PLEKHA1 |
Synonyms | PLEKHA1; pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1; pleckstrin homology domain-containing family A member 1; tandem PH domain containing protein 1; TAPP1; tandem PH domain-containing protein 1; |
Gene ID | 59338 |
mRNA Refseq | NM_001001974 |
Protein Refseq | NP_001001974 |
MIM | 607772 |
UniProt ID | Q9HB21 |
◆ Recombinant Proteins | ||
PLEKHA1-12941M | Recombinant Mouse PLEKHA1 Protein | +Inquiry |
Plekha1-1590M | Recombinant Mouse Plekha1 protein, His & GST-tagged | +Inquiry |
PLEKHA1-12607Z | Recombinant Zebrafish PLEKHA1 | +Inquiry |
PLEKHA1-5066H | Recombinant Human PLEKHA1 Protein (Leu92-Glu346), N-His tagged | +Inquiry |
PLEKHA1-2108H | Recombinant Human PLEKHA1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLEKHA1-1372HCL | Recombinant Human PLEKHA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLEKHA1 Products
Required fields are marked with *
My Review for All PLEKHA1 Products
Required fields are marked with *