Recombinant Human PLP1 Full Length Transmembrane protein (2-277 aa), His-tagged
| Cat.No. : | PLP1-2728H |
| Product Overview : | Recombinant Human PLP1 Protein (2-277 aa) is produced by in vitro E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-277aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.5 kDa |
| AA Sequence : | GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PLP1 proteolipid protein 1 [ Homo sapiens ] |
| Official Symbol | PLP1 |
| Synonyms | PLP1; proteolipid protein 1; PLP, spastic paraplegia 2, uncomplicated , SPG2; myelin proteolipid protein; Pelizaeus Merzbacher disease; lipophilin; major myelin proteolipid protein; PLP; PMD; HLD1; MMPL; SPG2; PLP/DM20; |
| Gene ID | 5354 |
| mRNA Refseq | NM_000533 |
| Protein Refseq | NP_000524 |
| MIM | 300401 |
| UniProt ID | P60201 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLP1 Products
Required fields are marked with *
My Review for All PLP1 Products
Required fields are marked with *
