Recombinant Human PLSCR3 protein, GST-tagged
Cat.No. : | PLSCR3-301574H |
Product Overview : | Recombinant Human PLSCR3 (1-295 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ser295 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAITS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | PLSCR3 phospholipid scramblase 3 [ Homo sapiens ] |
Official Symbol | PLSCR3 |
Synonyms | PLSCR3; phospholipid scramblase 3; PL scramblase 3; ca(2+)-dependent phospholipid scramblase 3; |
Gene ID | 57048 |
mRNA Refseq | NM_001201576 |
Protein Refseq | NP_001188505 |
MIM | 607611 |
UniProt ID | Q9NRY6 |
◆ Recombinant Proteins | ||
PLSCR3-301H | Recombinant Human phospholipid scramblase 3, His-tagged | +Inquiry |
PLSCR3-4535R | Recombinant Rat PLSCR3 Protein | +Inquiry |
PLSCR3-3479R | Recombinant Rhesus monkey PLSCR3 Protein, His-tagged | +Inquiry |
PLSCR3-4195R | Recombinant Rat PLSCR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Plscr3-4942M | Recombinant Mouse Plscr3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLSCR3-1381HCL | Recombinant Human PLSCR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLSCR3 Products
Required fields are marked with *
My Review for All PLSCR3 Products
Required fields are marked with *