Recombinant Human PLXNB1 protein, His&Myc-tagged
| Cat.No. : | PLXNB1-7544H |
| Product Overview : | Recombinant Human PLXNB1 protein(O43157)(35-150aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 35-150a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 19.9 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | LQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAV |
| Gene Name | PLXNB1 plexin B1 [ Homo sapiens ] |
| Official Symbol | PLXNB1 |
| Synonyms | PLXNB1; plexin B1; PLXN5; plexin-B1; KIAA0407; SEP; plexin 5; semaphorin receptor SEP; PLEXIN-B1; MGC149167; |
| Gene ID | 5364 |
| mRNA Refseq | NM_001130082 |
| Protein Refseq | NP_001123554 |
| MIM | 601053 |
| UniProt ID | O43157 |
| ◆ Recombinant Proteins | ||
| PLXNB1-4827H | Recombinant Human PLXNB1 Protein, His-tagged | +Inquiry |
| PLXNB1-740H | Recombinant Human PLXNB1 Protein, His-tagged | +Inquiry |
| PLXNB1-4605C | Recombinant Chicken PLXNB1 | +Inquiry |
| PLXNB1-741H | Recombinant Human PLXNB1 Protein, His-tagged | +Inquiry |
| PLXNB1-4939H | Recombinant Human PLXNB1 Protein (Met1390-Val1463), N-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| PLXNB1-001H | Recombinant Human PLXNB1 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLXNB1 Products
Required fields are marked with *
My Review for All PLXNB1 Products
Required fields are marked with *
