Recombinant Human PLXNB1 Protein, His tagged
Cat.No. : | PLXNB1-001H |
Product Overview : | Recombinant Human PLXNB1 Protein (35-150 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 35-150 aa |
Description : | Enables semaphorin receptor activity. Involved in several processes, including negative regulation of cell adhesion; regulation of cell shape; and semaphorin-plexin signaling pathway. Located in plasma membrane. Part of semaphorin receptor complex. |
Molecular Mass : | 14 kDa |
Purity : | > 90% by SDS-PAGE |
AA Sequence : | MLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVHHHHHHHH |
Endotoxin : | < 1.0 EU/μg by LAL |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH8.2, 8% Trehalose, 10% Glycerol |
Concentration : | 1 mg/mL by BCA |
Gene Name | PLXNB1 plexin B1 [ Homo sapiens (human) ] |
Official Symbol | PLXNB1 |
Synonyms | PLXNB1; plexin B1; PLXN5; plexin-B1; KIAA0407; SEP; plexin 5; semaphorin receptor SEP; PLEXIN-B1; MGC149167 |
Gene ID | 5364 |
mRNA Refseq | NM_001130082 |
Protein Refseq | NP_001123554 |
MIM | 601053 |
UniProt ID | O43157 |
◆ Recombinant Proteins | ||
Plxnb1-744M | Recombinant Mouse Plxnb1 Protein, His-tagged | +Inquiry |
PLXNB1-7544H | Recombinant Human PLXNB1 protein, His&Myc-tagged | +Inquiry |
PLXNB1-4940H | Recombinant Human PLXNB1 Protein, His-tagged | +Inquiry |
PLXNB1-740H | Recombinant Human PLXNB1 Protein, His-tagged | +Inquiry |
PLXNB1-4605C | Recombinant Chicken PLXNB1 | +Inquiry |
◆ Native Proteins | ||
PLXNB1-001H | Recombinant Human PLXNB1 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLXNB1 Products
Required fields are marked with *
My Review for All PLXNB1 Products
Required fields are marked with *