Recombinant Human PLXNB1 Protein, His tagged

Cat.No. : PLXNB1-001H
Product Overview : Recombinant Human PLXNB1 Protein (35-150 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 35-150 aa
Description : Enables semaphorin receptor activity. Involved in several processes, including negative regulation of cell adhesion; regulation of cell shape; and semaphorin-plexin signaling pathway. Located in plasma membrane. Part of semaphorin receptor complex.
Molecular Mass : 14 kDa
Purity : > 90% by SDS-PAGE
AA Sequence : MLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVHHHHHHHH
Endotoxin : < 1.0 EU/μg by LAL
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH8.2, 8% Trehalose, 10% Glycerol
Concentration : 1 mg/mL by BCA
Gene Name PLXNB1 plexin B1 [ Homo sapiens (human) ]
Official Symbol PLXNB1
Synonyms PLXNB1; plexin B1; PLXN5; plexin-B1; KIAA0407; SEP; plexin 5; semaphorin receptor SEP; PLEXIN-B1; MGC149167
Gene ID 5364
mRNA Refseq NM_001130082
Protein Refseq NP_001123554
MIM 601053
UniProt ID O43157

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLXNB1 Products

Required fields are marked with *

My Review for All PLXNB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon