Recombinant Human PLXNB1 Protein, His tagged

• Cat.No.: PLXNB1-001H
• Product Overview: Recombinant Human PLXNB1 Protein (35-150 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 35-150 aa
• Description: Enables semaphorin receptor activity. Involved in several processes, including negative regulation of cell adhesion; regulation of cell shape; and semaphorin-plexin signaling pathway. Located in plasma membrane. Part of semaphorin receptor complex.
• Molecular Mass: 14 kDa
• Purity: > 90% by SDS-PAGE
• AA Sequence: MLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVHHHHHHHH
• Endotoxin: < 1.0 EU/μg by LAL
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH8.2, 8% Trehalose, 10% Glycerol
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: PLXNB1 plexin B1 [ Homo sapiens (human) ]
• Official Symbol: PLXNB1
• Synonyms: PLXNB1; plexin B1; PLXN5; plexin-B1; KIAA0407; SEP; plexin 5; semaphorin receptor SEP; PLEXIN-B1; MGC149167
• Gene ID: 5364
• mRNA Refseq: NM_001130082
• Protein Refseq: NP_001123554
• MIM: 601053
• UniProt ID: O43157