Recombinant Human PMAIP1 protein, GST-tagged
Cat.No. : | PMAIP1-301210H |
Product Overview : | Recombinant Human PMAIP1 (1-54 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Thr54 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PMAIP1 phorbol-12-myristate-13-acetate-induced protein 1 [ Homo sapiens ] |
Official Symbol | PMAIP1 |
Synonyms | PMAIP1; phorbol-12-myristate-13-acetate-induced protein 1; APR; NOXA; protein Noxa; PMA-induced protein 1; immediate-early-response protein APR; adult T cell leukemia-derived PMA-responsive; |
Gene ID | 5366 |
mRNA Refseq | NM_021127 |
Protein Refseq | NP_066950 |
MIM | 604959 |
UniProt ID | Q13794 |
◆ Recombinant Proteins | ||
PMAIP1-13007M | Recombinant Mouse PMAIP1 Protein | +Inquiry |
PMAIP1-4415Z | Recombinant Zebrafish PMAIP1 | +Inquiry |
PMAIP1-1804H | Recombinant Human PMAIP1 protein, His-tagged | +Inquiry |
PMAIP1-4199R | Recombinant Rat PMAIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PMAIP1-3049H | Recombinant Human PMAIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PMAIP1-3090HCL | Recombinant Human PMAIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PMAIP1 Products
Required fields are marked with *
My Review for All PMAIP1 Products
Required fields are marked with *