Recombinant Human PMM1 protein, GST-tagged
Cat.No. : | PMM1-1808H |
Product Overview : | Recombinant Human PMM1 protein(1-262 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | August 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-262 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | PMM1 |
Synonyms | PMM1; phosphomannomutase 1; brain glucose 1; 6 bisphosphatase; Sec53; PMM 1; PMMH-22; brain glucose-1,6-bisphosphatase; |
Gene ID | 5372 |
mRNA Refseq | NM_002676 |
Protein Refseq | NP_002667 |
MIM | 601786 |
UniProt ID | Q92871 |
◆ Recombinant Proteins | ||
PMM1-1422H | Recombinant Human Phosphomannomutase 1, His-tagged | +Inquiry |
PMM1-803H | Recombinant Human Phosphomannomutase 1, His-tagged | +Inquiry |
Pmm1-4955M | Recombinant Mouse Pmm1 Protein, Myc/DDK-tagged | +Inquiry |
PMM1-156H | Recombinant Human PMM1 Protein, His-tagged | +Inquiry |
PMM1-1808H | Recombinant Human PMM1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PMM1-3088HCL | Recombinant Human PMM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PMM1 Products
Required fields are marked with *
My Review for All PMM1 Products
Required fields are marked with *