Recombinant Human PMP22

• Cat.No.: PMP22-30913TH
• Product Overview: Recombinant fragment corresponding to amino acids 25-114 of Human PMP22 with proprietary tag: Predicted MWt 35.53 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing of this gene results in three transcript variants that encode the same protein.
• Molecular Weight: 35.530kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAA
• Sequence Similarities: Belongs to the PMP-22/EMP/MP20 family.

Gene Information

• Gene Name: PMP22 peripheral myelin protein 22 [ Homo sapiens ]
• Official Symbol: PMP22
• Synonyms: PMP22; peripheral myelin protein 22; GAS 3; HNPP; Sp110
• Gene ID: 5376
• mRNA Refseq: NM_000304
• Protein Refseq: NP_000295
• MIM: 601097
• Uniprot ID: Q01453
• Chromosome Location: 17p12
• Pathway: a6b1 and a6b4 Integrin signaling, organism-specific biosystem