Recombinant Human PMP22

Cat.No. : PMP22-30913TH
Product Overview : Recombinant fragment corresponding to amino acids 25-114 of Human PMP22 with proprietary tag: Predicted MWt 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing of this gene results in three transcript variants that encode the same protein.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAA
Sequence Similarities : Belongs to the PMP-22/EMP/MP20 family.
Gene Name PMP22 peripheral myelin protein 22 [ Homo sapiens ]
Official Symbol PMP22
Synonyms PMP22; peripheral myelin protein 22; GAS 3; HNPP; Sp110;
Gene ID 5376
mRNA Refseq NM_000304
Protein Refseq NP_000295
MIM 601097
Uniprot ID Q01453
Chromosome Location 17p12
Pathway a6b1 and a6b4 Integrin signaling, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PMP22 Products

Required fields are marked with *

My Review for All PMP22 Products

Required fields are marked with *

0
cart-icon
0
compare icon