Recombinant Human PMP22
| Cat.No. : | PMP22-30913TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 25-114 of Human PMP22 with proprietary tag: Predicted MWt 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 90 amino acids |
| Description : | This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing of this gene results in three transcript variants that encode the same protein. |
| Molecular Weight : | 35.530kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | VSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAA |
| Sequence Similarities : | Belongs to the PMP-22/EMP/MP20 family. |
| Gene Name | PMP22 peripheral myelin protein 22 [ Homo sapiens ] |
| Official Symbol | PMP22 |
| Synonyms | PMP22; peripheral myelin protein 22; GAS 3; HNPP; Sp110; |
| Gene ID | 5376 |
| mRNA Refseq | NM_000304 |
| Protein Refseq | NP_000295 |
| MIM | 601097 |
| Uniprot ID | Q01453 |
| Chromosome Location | 17p12 |
| Pathway | a6b1 and a6b4 Integrin signaling, organism-specific biosystem; |
| ◆ Recombinant Proteins | ||
| PMP22-4717C | Recombinant Chicken PMP22 | +Inquiry |
| PMP22-4943H | Recombinant Human PMP22 Protein (Gly31-Gly133), N-His tagged | +Inquiry |
| PMP22-1718H | Recombinant Human PMP22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL464HF | Recombinant Full Length Human Peripheral Myelin Protein 22(Pmp22) Protein, His-Tagged | +Inquiry |
| PMP22-4473H | Recombinant Human PMP22 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PMP22 Products
Required fields are marked with *
My Review for All PMP22 Products
Required fields are marked with *


