Recombinant Human PMP22
Cat.No. : | PMP22-30913TH |
Product Overview : | Recombinant fragment corresponding to amino acids 25-114 of Human PMP22 with proprietary tag: Predicted MWt 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing of this gene results in three transcript variants that encode the same protein. |
Molecular Weight : | 35.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAA |
Sequence Similarities : | Belongs to the PMP-22/EMP/MP20 family. |
Gene Name | PMP22 peripheral myelin protein 22 [ Homo sapiens ] |
Official Symbol | PMP22 |
Synonyms | PMP22; peripheral myelin protein 22; GAS 3; HNPP; Sp110; |
Gene ID | 5376 |
mRNA Refseq | NM_000304 |
Protein Refseq | NP_000295 |
MIM | 601097 |
Uniprot ID | Q01453 |
Chromosome Location | 17p12 |
Pathway | a6b1 and a6b4 Integrin signaling, organism-specific biosystem; |
◆ Recombinant Proteins | ||
PMP22-1810H | Recombinant Human PMP22, GST-tagged | +Inquiry |
PMP22-4717C | Recombinant Chicken PMP22 | +Inquiry |
PMP22-1812H | Recombinant Human PMP22 Protein, His-SUMO-tagged | +Inquiry |
PMP22-30913TH | Recombinant Human PMP22 | +Inquiry |
PMP22-4716C | Recombinant Chicken PMP22 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PMP22 Products
Required fields are marked with *
My Review for All PMP22 Products
Required fields are marked with *
0
Inquiry Basket