Recombinant Human PNMA1, His-tagged
Cat.No. : | PNMA1-28604TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 152-353 of Human PNMA1 with N terminal His tag; Predicted MWt 24 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 152-353 a.a. |
Description : | The PNMA1 gene encodes an antineuronal antibody (anti-Ma) present in patients with paraneoplastic neurologic disorders (Dalmau et al. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 82 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LVESIWYKRLTLFSGRDIPGPGEETFDPWLEHTNEVLEEW QVSDVEKRRRLMESLRGPAADVIRILKSNNPAITTAEC LKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR LEPLLQKVVEKGAIDKDNVNQARLEQVIAGANHSGAIR RQLWLTGAGEGPAPNLFQLLVQIREEEAKEEEEEAEATLLQLGLEGHF |
Gene Name | PNMA1 paraneoplastic antigen MA1 [ Homo sapiens ] |
Official Symbol | PNMA1 |
Synonyms | PNMA1; paraneoplastic antigen MA1; paraneoplastic antigen Ma1; MA1; |
Gene ID | 9240 |
mRNA Refseq | NM_006029 |
Protein Refseq | NP_006020 |
MIM | 604010 |
Uniprot ID | Q8ND90 |
Chromosome Location | 14q24.3 |
Function | protein binding; |
◆ Recombinant Proteins | ||
PNMA1-4548R | Recombinant Rat PNMA1 Protein | +Inquiry |
PNMA1-6880M | Recombinant Mouse PNMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pnma1-4966M | Recombinant Mouse Pnma1 Protein, Myc/DDK-tagged | +Inquiry |
PNMA1-3306R | Recombinant Rhesus Macaque PNMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PNMA1-3352H | Recombinant Human PNMA1 protein, His-B2M-JD & Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNMA1-3081HCL | Recombinant Human PNMA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNMA1 Products
Required fields are marked with *
My Review for All PNMA1 Products
Required fields are marked with *