Recombinant Human PNMA1, His-tagged
Cat.No. : | PNMA1-28604TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 152-353 of Human PNMA1 with N terminal His tag; Predicted MWt 24 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The PNMA1 gene encodes an antineuronal antibody (anti-Ma) present in patients with paraneoplastic neurologic disorders (Dalmau et al. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 82 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LVESIWYKRLTLFSGRDIPGPGEETFDPWLEHTNEVLEEW QVSDVEKRRRLMESLRGPAADVIRILKSNNPAITTAEC LKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIR LEPLLQKVVEKGAIDKDNVNQARLEQVIAGANHSGAIR RQLWLTGAGEGPAPNLFQLLVQIREEEAKEEEEEAEATLLQLGLEGHF |
Gene Name : | PNMA1 paraneoplastic antigen MA1 [ Homo sapiens ] |
Official Symbol : | PNMA1 |
Synonyms : | PNMA1; paraneoplastic antigen MA1; paraneoplastic antigen Ma1; MA1; |
Gene ID : | 9240 |
mRNA Refseq : | NM_006029 |
Protein Refseq : | NP_006020 |
MIM : | 604010 |
Uniprot ID : | Q8ND90 |
Chromosome Location : | 14q24.3 |
Function : | protein binding; |
Products Types
◆ Recombinant Protein | ||
PNMA1-6880M | Recombinant Mouse PNMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PNMA1-3306R | Recombinant Rhesus Macaque PNMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pnma1-4966M | Recombinant Mouse Pnma1 Protein, Myc/DDK-tagged | +Inquiry |
PNMA1-4208R | Recombinant Rat PNMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PNMA1-3488R | Recombinant Rhesus monkey PNMA1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
PNMA1-3081HCL | Recombinant Human PNMA1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket