Recombinant Human PNN
Cat.No. : | PNN-30966TH |
Product Overview : | Recombinant fragment of Human Pinin with N-terminal proprietary tag.Mol Wt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5CAGGTG-3. Capable of reversing CTBP1-mediated transcription repression. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon, heart, epidermis, esophagus, brain and smooth and skeletal muscle. Expressed strongly in melanoma metastasis lesions and advanced primar |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHLFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN |
Sequence Similarities : | Belongs to the pinin family. |
Gene Name | PNN pinin, desmosome associated protein [ Homo sapiens ] |
Official Symbol | PNN |
Synonyms | PNN; pinin, desmosome associated protein; pinin; memA; |
Gene ID | 5411 |
mRNA Refseq | NM_002687 |
Protein Refseq | NP_002678 |
MIM | 603154 |
Uniprot ID | Q9H307 |
Chromosome Location | 14q21.1 |
Pathway | Exon junction complex (EJC), organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem; |
Function | DNA binding; structural molecule activity; |
◆ Recombinant Proteins | ||
PNN-30966TH | Recombinant Human PNN | +Inquiry |
PNN-7688Z | Recombinant Zebrafish PNN | +Inquiry |
PNN-13036M | Recombinant Mouse PNN Protein | +Inquiry |
PNN-6885M | Recombinant Mouse PNN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNN-3074HCL | Recombinant Human PNN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNN Products
Required fields are marked with *
My Review for All PNN Products
Required fields are marked with *
0
Inquiry Basket