Recombinant Human POFUT2, His-tagged
| Cat.No. : | POFUT2-27511TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 196-429 of Human POFUT2 with N terminal His tag; Predicted MWt 28 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 196-429 a.a. |
| Description : | Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor (EGF; MIM 131530)-like repeats or thrombospondin (THBS; see MIM 188060) type-1 repeats. POFUT2 is an O-fucosyltransferase that use THBS type-1 repeats as substrates (Luo et al. |
| Conjugation : | HIS |
| Tissue specificity : | Isoform A is expressed in fetal liver and peripheral blood lymphocytes. Isoform B is expressed in spleen, lung, testis, bone marrow, thymus, pancreas, prostate, fetal brain, fetal liver and fetal kidney. Isoform C is expressed in brain, heart, spleen, liv |
| Form : | Lyophilised:Reconstitute with 133 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWD TRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDW MKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEG AVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEM VRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTF SFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKI TY |
| Sequence Similarities : | Belongs to the glycosyltransferase 68 family. |
| Gene Name | POFUT2 protein O-fucosyltransferase 2 [ Homo sapiens ] |
| Official Symbol | POFUT2 |
| Synonyms | POFUT2; protein O-fucosyltransferase 2; C21orf80, chromosome 21 open reading frame 80; GDP-fucose protein O-fucosyltransferase 2; FUT13; KIAA0958; |
| Gene ID | 23275 |
| mRNA Refseq | NM_015227 |
| Protein Refseq | NP_056042 |
| MIM | 610249 |
| Uniprot ID | Q9Y2G5 |
| Chromosome Location | 21q22.3 |
| Pathway | Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem; |
| Function | peptide-O-fucosyltransferase activity; transferase activity, transferring glycosyl groups; |
| ◆ Recombinant Proteins | ||
| Pofut2-4979M | Recombinant Mouse Pofut2 Protein, Myc/DDK-tagged | +Inquiry |
| POFUT2-6576HFL | Recombinant Full Length Human POFUT2 protein, Flag-tagged | +Inquiry |
| POFUT2-1825H | Recombinant Human POFUT2, GST-tagged | +Inquiry |
| POFUT2-27511TH | Recombinant Human POFUT2, His-tagged | +Inquiry |
| POFUT2-3892H | Recombinant Human POFUT2 protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POFUT2-3056HCL | Recombinant Human POFUT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POFUT2 Products
Required fields are marked with *
My Review for All POFUT2 Products
Required fields are marked with *
