Recombinant Human POLG
| Cat.No. : | POLG-28364TH |
| Product Overview : | Recombinant fragment of Human DNA Polymerase gamma with an N terminal proprietary tag; predicted mwt: 37.73 inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | Mitochondrial DNA polymerase is heterotrimeric, consisting of a homodimer of accessory subunits plus a catalytic subunit. The protein encoded by this gene is the catalytic subunit of mitochondrial DNA polymerase. The encoded protein contains a polyglutamine tract near its N-terminus that may be polymorphic. Defects in this gene are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions 1 (PEOA1), sensory ataxic neuropathy dysarthria and ophthalmoparesis (SANDO), Alpers-Huttenlocher syndrome (AHS), and mitochondrial neurogastrointestinal encephalopathy syndrome (MNGIE). Two transcript variants encoding the same protein have been found for this gene. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | CISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLG LNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERR YGIPQGEALDIYQIIELTKGSLEKRSQPGP |
| Sequence Similarities : | Belongs to the DNA polymerase type-A family. |
| Gene Name | POLG polymerase (DNA directed), gamma [ Homo sapiens ] |
| Official Symbol | POLG |
| Synonyms | POLG; polymerase (DNA directed), gamma; DNA polymerase subunit gamma-1; POLG1; POLGA; |
| Gene ID | 5428 |
| mRNA Refseq | NM_001126131 |
| Protein Refseq | NP_001119603 |
| MIM | 174763 |
| Uniprot ID | P54098 |
| Chromosome Location | 15q24 |
| Pathway | DNA polymerase gamma complex, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; |
| Function | DNA binding; DNA-directed DNA polymerase activity; chromatin binding; exonuclease activity; nucleotidyltransferase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLG Products
Required fields are marked with *
My Review for All POLG Products
Required fields are marked with *
