Recombinant Human POLG
Cat.No. : | POLG-28364TH |
Product Overview : | Recombinant fragment of Human DNA Polymerase gamma with an N terminal proprietary tag; predicted mwt: 37.73 inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Mitochondrial DNA polymerase is heterotrimeric, consisting of a homodimer of accessory subunits plus a catalytic subunit. The protein encoded by this gene is the catalytic subunit of mitochondrial DNA polymerase. The encoded protein contains a polyglutamine tract near its N-terminus that may be polymorphic. Defects in this gene are a cause of progressive external ophthalmoplegia with mitochondrial DNA deletions 1 (PEOA1), sensory ataxic neuropathy dysarthria and ophthalmoparesis (SANDO), Alpers-Huttenlocher syndrome (AHS), and mitochondrial neurogastrointestinal encephalopathy syndrome (MNGIE). Two transcript variants encoding the same protein have been found for this gene. |
Molecular Weight : | 37.730kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLG LNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERR YGIPQGEALDIYQIIELTKGSLEKRSQPGP |
Sequence Similarities : | Belongs to the DNA polymerase type-A family. |
Gene Name | POLG polymerase (DNA directed), gamma [ Homo sapiens ] |
Official Symbol | POLG |
Synonyms | POLG; polymerase (DNA directed), gamma; DNA polymerase subunit gamma-1; POLG1; POLGA; |
Gene ID | 5428 |
mRNA Refseq | NM_001126131 |
Protein Refseq | NP_001119603 |
MIM | 174763 |
Uniprot ID | P54098 |
Chromosome Location | 15q24 |
Pathway | DNA polymerase gamma complex, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Nucleotide Metabolism, organism-specific biosystem; |
Function | DNA binding; DNA-directed DNA polymerase activity; chromatin binding; exonuclease activity; nucleotidyltransferase activity; |
◆ Recombinant Proteins | ||
POLG-1528H | Recombinant Hepatitis C virus genotype 1b POLG Protein (S2420-R2989) | +Inquiry |
POLG-317H | Recombinant Human POLG Protein, His-tagged | +Inquiry |
POLG-28364TH | Recombinant Human POLG | +Inquiry |
POLG-632H | Recombinant Human POLG protein | +Inquiry |
POLG-4225R | Recombinant Rat POLG Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLG Products
Required fields are marked with *
My Review for All POLG Products
Required fields are marked with *