Recombinant Human POLR1D Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | POLR1D-1838H | 
| Product Overview : | POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_689918) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants. | 
| Molecular Mass : | 14.3 kDa | 
| AA Sequence : | MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | POLR1D RNA polymerase I and III subunit D [ Homo sapiens (human) ] | 
| Official Symbol | POLR1D | 
| Synonyms | POLR1D; polymerase (RNA) I polypeptide D, 16kDa; DNA-directed RNA polymerases I and III subunit RPAC2; MGC9850; RPA9; RPA16; RPAC2; RPO1 3; RNA polymerases I and III subunit AC2; DNA-directed RNA polymerase I subunit D; AC19; TCS2; RPC16; POLR1C; RPO1-3; FLJ20616; | 
| Gene ID | 51082 | 
| mRNA Refseq | NM_152705 | 
| Protein Refseq | NP_689918 | 
| MIM | 613715 | 
| UniProt ID | Q9Y2S0 | 
| ◆ Recombinant Proteins | ||
| POLR1D-1838H | Recombinant Human POLR1D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| POLR1D-3330R | Recombinant Rhesus Macaque POLR1D Protein, His (Fc)-Avi-tagged | +Inquiry | 
| POLR1D-6919M | Recombinant Mouse POLR1D Protein, His (Fc)-Avi-tagged | +Inquiry | 
| POLR1D-1839H | Recombinant Human POLR1D, GST-tagged | +Inquiry | 
| POLR1D-13089M | Recombinant Mouse POLR1D Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| POLR1D-3040HCL | Recombinant Human POLR1D 293 Cell Lysate | +Inquiry | 
| POLR1D-3039HCL | Recombinant Human POLR1D 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR1D Products
Required fields are marked with *
My Review for All POLR1D Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            