Recombinant Human POLR1D Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: POLR1D-1838H
• Product Overview: POLR1D MS Standard C13 and N15-labeled recombinant protein (NP_689918) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a component of the RNA polymerase I and RNA polymerase III complexes, which function in the synthesis of ribosomal RNA precursors and small RNAs, respectively. Mutations in this gene are a cause of Treacher Collins syndrome (TCS), a craniofacial development disorder. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 14.3 kDa
• AA Sequence: MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: POLR1D RNA polymerase I and III subunit D [ Homo sapiens (human) ]
• Official Symbol: POLR1D
• Synonyms: POLR1D; polymerase (RNA) I polypeptide D, 16kDa; DNA-directed RNA polymerases I and III subunit RPAC2; MGC9850; RPA9; RPA16; RPAC2; RPO1 3; RNA polymerases I and III subunit AC2; DNA-directed RNA polymerase I subunit D; AC19; TCS2; RPC16; POLR1C; RPO1-3; FLJ20616
• Gene ID: 51082
• mRNA Refseq: NM_152705
• Protein Refseq: NP_689918
• MIM: 613715
• UniProt ID: Q9Y2S0