Recombinant Human POLR2M, His-tagged
Cat.No. : | POLR2M-28539TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 32-211 of Human GRINL1A with N terminal His tag; 180 amino acids, 42kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a subunit of RNA polymerase II, a protein complex that is responsible for synthesizing messenger RNA in eukaryotes. The encoded protein functions as a component of a specific form of RNA polymerase II termed Pol II(G). This protein may act as a negative regulator of activator-dependent transcription. Alternate splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring upstream gene MYZAP (myocardial zonula adherens protein). |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 87 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ERLLRNELQRITIADQGEQQSEENASTKNLTGLSSGTEKK PHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQ KSGSPISSEERRRRDKQHLDDITAARLLPLHHMPTQLL SIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYN PEGESSGRYREVRDEDDDWSSDEF |
Gene Name : | POLR2M polymerase (RNA) II (DNA directed) polypeptide M [ Homo sapiens ] |
Official Symbol : | POLR2M |
Synonyms : | POLR2M; polymerase (RNA) II (DNA directed) polypeptide M; glutamate receptor, ionotropic, N methyl D aspartate like 1A , GRINL1A; protein GRINL1A; GCOM1; Gdown; Gdown1; |
Gene ID : | 81488 |
mRNA Refseq : | NM_001018102 |
Protein Refseq : | NP_001018112 |
MIM : | 606485 |
Uniprot ID : | P0CAP2 |
Chromosome Location : | 15q21.3 |
Function : | DNA-directed RNA polymerase activity; |
Products Types
◆ Recombinant Protein | ||
Polr2m-5003M | Recombinant Mouse Polr2m Protein, Myc/DDK-tagged | +Inquiry |
POLR2M-4232R | Recombinant Rat POLR2M Protein, His (Fc)-Avi-tagged | +Inquiry |
POLR2M-6928M | Recombinant Mouse POLR2M Protein, His (Fc)-Avi-tagged | +Inquiry |
POLR2M-5348H | Recombinant Human POLR2M Protein, GST-tagged | +Inquiry |
POLR2M-1731H | Recombinant Human POLR2M Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
POLR2M-5742HCL | Recombinant Human GRINL1A 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket