Recombinant Human POLR2M, His-tagged

Cat.No. : POLR2M-28539TH
Product Overview : Recombinant fragment, corresponding to amino acids 32-211 of Human GRINL1A with N terminal His tag; 180 amino acids, 42kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 32-211 a.a.
Description : This gene encodes a subunit of RNA polymerase II, a protein complex that is responsible for synthesizing messenger RNA in eukaryotes. The encoded protein functions as a component of a specific form of RNA polymerase II termed Pol II(G). This protein may act as a negative regulator of activator-dependent transcription. Alternate splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring upstream gene MYZAP (myocardial zonula adherens protein).
Conjugation : HIS
Form : Lyophilised:Reconstitute with 87 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ERLLRNELQRITIADQGEQQSEENASTKNLTGLSSGTEKK PHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQ KSGSPISSEERRRRDKQHLDDITAARLLPLHHMPTQLL SIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYN PEGESSGRYREVRDEDDDWSSDEF
Gene Name POLR2M polymerase (RNA) II (DNA directed) polypeptide M [ Homo sapiens ]
Official Symbol POLR2M
Synonyms POLR2M; polymerase (RNA) II (DNA directed) polypeptide M; glutamate receptor, ionotropic, N methyl D aspartate like 1A , GRINL1A; protein GRINL1A; GCOM1; Gdown; Gdown1;
Gene ID 81488
mRNA Refseq NM_001018102
Protein Refseq NP_001018112
MIM 606485
Uniprot ID P0CAP2
Chromosome Location 15q21.3
Function DNA-directed RNA polymerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR2M Products

Required fields are marked with *

My Review for All POLR2M Products

Required fields are marked with *

0
cart-icon