Recombinant Human POLR2M, His-tagged
| Cat.No. : | POLR2M-28539TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 32-211 of Human GRINL1A with N terminal His tag; 180 amino acids, 42kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 32-211 a.a. |
| Description : | This gene encodes a subunit of RNA polymerase II, a protein complex that is responsible for synthesizing messenger RNA in eukaryotes. The encoded protein functions as a component of a specific form of RNA polymerase II termed Pol II(G). This protein may act as a negative regulator of activator-dependent transcription. Alternate splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring upstream gene MYZAP (myocardial zonula adherens protein). |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 87 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | ERLLRNELQRITIADQGEQQSEENASTKNLTGLSSGTEKK PHYMEVLEMRAKNPVPQLRKFKTNVLPFRQNDSSSHCQ KSGSPISSEERRRRDKQHLDDITAARLLPLHHMPTQLL SIEESLALQKQQKQNYEEMQAKLAAQKLAERLNIKMRSYN PEGESSGRYREVRDEDDDWSSDEF |
| Gene Name | POLR2M polymerase (RNA) II (DNA directed) polypeptide M [ Homo sapiens ] |
| Official Symbol | POLR2M |
| Synonyms | POLR2M; polymerase (RNA) II (DNA directed) polypeptide M; glutamate receptor, ionotropic, N methyl D aspartate like 1A , GRINL1A; protein GRINL1A; GCOM1; Gdown; Gdown1; |
| Gene ID | 81488 |
| mRNA Refseq | NM_001018102 |
| Protein Refseq | NP_001018112 |
| MIM | 606485 |
| Uniprot ID | P0CAP2 |
| Chromosome Location | 15q21.3 |
| Function | DNA-directed RNA polymerase activity; |
| ◆ Recombinant Proteins | ||
| POLR2M-6928M | Recombinant Mouse POLR2M Protein, His (Fc)-Avi-tagged | +Inquiry |
| POLR2M-13103M | Recombinant Mouse POLR2M Protein | +Inquiry |
| POLR2M-4232R | Recombinant Rat POLR2M Protein, His (Fc)-Avi-tagged | +Inquiry |
| POLR2M-1731H | Recombinant Human POLR2M Protein, His (Fc)-Avi-tagged | +Inquiry |
| Polr2m-5003M | Recombinant Mouse Polr2m Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POLR2M-5742HCL | Recombinant Human GRINL1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR2M Products
Required fields are marked with *
My Review for All POLR2M Products
Required fields are marked with *
