Recombinant Human POU6F1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : POU6F1-640H
Product Overview : POU6F1 MS Standard C13 and N15-labeled recombinant protein (NP_002693) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3').
Molecular Mass : 32.6 kDa
AA Sequence : MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name POU6F1 POU class 6 homeobox 1 [ Homo sapiens (human) ]
Official Symbol POU6F1
Synonyms POU6F1; POU class 6 homeobox 1; POU domain, class 6, transcription factor 1; BRN5; MPOU; TCFB1; brn-5; brain-5; mPOU homeobox protein; brain-specific homeobox/POU domain protein 5;
Gene ID 5463
mRNA Refseq NM_002702
Protein Refseq NP_002693
MIM 618043
UniProt ID Q14863

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POU6F1 Products

Required fields are marked with *

My Review for All POU6F1 Products

Required fields are marked with *

0
cart-icon
0
compare icon