Recombinant Human POU6F1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | POU6F1-640H |
Product Overview : | POU6F1 MS Standard C13 and N15-labeled recombinant protein (NP_002693) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Transcription factor that binds preferentially to a variant of the octamer motif (5'-ATGATAAT-3'). |
Molecular Mass : | 32.6 kDa |
AA Sequence : | MPGISSQILTNAQGQVIGTLPWVVNSASVAAPAPAQSLQVQAVTPQLLLNAQGQVIATLASSPLPPPVAVRKPSTPESPAKSEVQPIQPTPTVPQPAVVIASPAPAAKPSASAPIPITCSETPTVSQLVSKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | POU6F1 POU class 6 homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | POU6F1 |
Synonyms | POU6F1; POU class 6 homeobox 1; POU domain, class 6, transcription factor 1; BRN5; MPOU; TCFB1; brn-5; brain-5; mPOU homeobox protein; brain-specific homeobox/POU domain protein 5; |
Gene ID | 5463 |
mRNA Refseq | NM_002702 |
Protein Refseq | NP_002693 |
MIM | 618043 |
UniProt ID | Q14863 |
◆ Recombinant Proteins | ||
POU6F1-13149M | Recombinant Mouse POU6F1 Protein | +Inquiry |
POU6F1-3025H | Recombinant Human POU6F1 protein, His-tagged | +Inquiry |
POU6F1-7615H | Recombinant Human POU6F1, His-tagged | +Inquiry |
POU6F1-4247R | Recombinant Rat POU6F1 Protein, His (Fc)-Avi-tagged | +Inquiry |
POU6F1-4587R | Recombinant Rat POU6F1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POU6F1-2997HCL | Recombinant Human POU6F1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POU6F1 Products
Required fields are marked with *
My Review for All POU6F1 Products
Required fields are marked with *