Recombinant Human PPA1 protein(1-289aa), GST-tagged
Cat.No. : | PPA1-1867H |
Product Overview : | Recombinant Human PPA1 protein(Q15181)(1-289aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | October 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-289aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 59.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN |
Gene Name | PPA1 pyrophosphatase (inorganic) 1 [ Homo sapiens ] |
Official Symbol | PPA1 |
Synonyms | PPA1; pyrophosphatase (inorganic) 1; PP, pyrophosphatase (inorganic); inorganic pyrophosphatase; cytosolic inorganic pyrophosphatase; inorganic pyrophosphatase 1; IOPPP; PP1; Ppase; pyrophosphate phospho hydrolase; SID6 8061; PPase; pyrophosphatase 1; inorganic diphosphatase; diphosphate phosphohydrolase; pyrophosphate phospho-hydrolase; PP; SID6-8061; MGC111556; |
Gene ID | 5464 |
mRNA Refseq | NM_021129 |
Protein Refseq | NP_066952 |
MIM | 179030 |
UniProt ID | Q15181 |
◆ Recombinant Proteins | ||
PPA1-28666TH | Recombinant Human PPA1, T7 -tagged | +Inquiry |
PPA1-3442H | Recombinant Human PPA1 protein, His-tagged | +Inquiry |
PPA1-1867H | Recombinant Human PPA1 protein(1-289aa), GST-tagged | +Inquiry |
PPA1-0913H | Recombinant Human PPA1 protein(228-289aa), His-tagged | +Inquiry |
PPA1-5998H | Recombinant Human PPA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPA1-2995HCL | Recombinant Human PPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPA1 Products
Required fields are marked with *
My Review for All PPA1 Products
Required fields are marked with *