Recombinant Human PPA1 Protein, Flag-tagged

Cat.No. : PPA1-22H
Product Overview : Recombinant Human PPA1 Protein is produced by HEK293T expression system. This protein is fused with a Flag tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag
Form : PBS buffer
Molecular Mass : 33 kDa
AA Sequence : MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Gene Name PPA1 pyrophosphatase (inorganic) 1 [ Homo sapiens ]
Official Symbol PPA1
Synonyms PPA1; IOPPP; PP1; Ppase; PPase; pyrophosphatase 1; PP; SID6-8061; MGC111556;
Gene ID 5464
mRNA Refseq NM_021129
Protein Refseq NP_066952
MIM 179030
UniProt ID Q15181

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPA1 Products

Required fields are marked with *

My Review for All PPA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon