Recombinant Human PPA1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PPA1-5998H |
| Product Overview : | PPA1 MS Standard C13 and N15-labeled recombinant protein (NP_066952) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. |
| Molecular Mass : | 32.7 kDa |
| AA Sequence : | MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PPA1 inorganic pyrophosphatase 1 [ Homo sapiens (human) ] |
| Official Symbol | PPA1 |
| Synonyms | PPA1; pyrophosphatase (inorganic) 1; PP, pyrophosphatase (inorganic); inorganic pyrophosphatase; cytosolic inorganic pyrophosphatase; inorganic pyrophosphatase 1; IOPPP; PP1; Ppase; pyrophosphate phospho hydrolase; SID6 8061; PPase; pyrophosphatase 1; inorganic diphosphatase; diphosphate phosphohydrolase; pyrophosphate phospho-hydrolase; PP; SID6-8061; MGC111556; |
| Gene ID | 5464 |
| mRNA Refseq | NM_021129 |
| Protein Refseq | NP_066952 |
| MIM | 179030 |
| UniProt ID | Q15181 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPA1 Products
Required fields are marked with *
My Review for All PPA1 Products
Required fields are marked with *
