Recombinant Human PPARA protein, His&Myc-tagged
Cat.No. : | PPARA-2251H |
Product Overview : | Recombinant Human PPARA protein(Q07869)(1-468aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 1-468aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 56.2 kDa |
AA Sequence : | MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PPARA peroxisome proliferator-activated receptor alpha [ Homo sapiens ] |
Official Symbol | PPARA |
Synonyms | PPARA; peroxisome proliferator-activated receptor alpha; peroxisome proliferative activated receptor, alpha , PPAR; hPPAR; NR1C1; PPAR-alpha; nuclear receptor subfamily 1 group C member 1; peroxisome proliferative activated receptor, alpha; peroxisome proliferator-activated nuclear receptor alpha variant 3; PPAR; PPARalpha; MGC2237; MGC2452; |
Gene ID | 5465 |
mRNA Refseq | NM_001001928 |
Protein Refseq | NP_001001928 |
UniProt ID | Q07869 |
◆ Recombinant Proteins | ||
PPARA-1084H | Active Recombinant Full Length Human PPARA, GST-tagged | +Inquiry |
PPARA-6967M | Recombinant Mouse PPARA Protein, His (Fc)-Avi-tagged | +Inquiry |
PPARA-5940H | Recombinant Human PPARA Protein (Ala201-Tyr468), C-His tagged | +Inquiry |
PPARA-1083H | Active Recombinant Full Length Human Peroxisome Proliferator-activated Receptor Alpha/PPARA, His-tagged | +Inquiry |
PPARA-1107C | Recombinant Chicken PPARA | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPARA-2987HCL | Recombinant Human PPARA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPARA Products
Required fields are marked with *
My Review for All PPARA Products
Required fields are marked with *
0
Inquiry Basket