Recombinant Human PPARD protein, His-tagged

Cat.No. : PPARD-11H
Product Overview : Recombinant Human PPARD(102-361aa) fused with His was expressed in E. coli.
Availability August 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 102-361 a.a.
Form : Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and 10% glycerol.
AA Sequence : IRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGGE
Stability : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Gene Name PPARD peroxisome proliferator-activated receptor delta [ Homo sapiens ]
Official Symbol PPARD
Synonyms PPARD; peroxisome proliferator-activated receptor delta; peroxisome proliferative activated receptor, delta; FAAR; NR1C2; NUC1; NUCII; PPAR-beta; PPAR-delta; nuclear hormone receptor 1; nuclear receptor subfamily 1 group C member 2; peroxisome proliferator-activated receptor beta; peroxisome proliferator-activated nuclear receptor beta/delta variant 2; NUCI; PPARB; MGC3931;
Gene ID 5467
mRNA Refseq NM_001171818
Protein Refseq NP_001165289
MIM 600409
UniProt ID Q03181
Chromosome Location 6p21.2
Pathway Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adipogenesis, organism-specific biosystem; Energy Metabolism, organism-specific biosystem; Gene expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem;
Function DNA binding; drug binding; fatty acid binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; linoleic acid binding; lipid binding; metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPARD Products

Required fields are marked with *

My Review for All PPARD Products

Required fields are marked with *

0
cart-icon