Recombinant Human PPARD protein, His-tagged
| Cat.No. : | PPARD-11H |
| Product Overview : | Recombinant Human PPARD(102-361aa) fused with His was expressed in E. coli. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 102-361 a.a. |
| Form : | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and 10% glycerol. |
| AA Sequence : | IRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGGE |
| Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Gene Name | PPARD peroxisome proliferator-activated receptor delta [ Homo sapiens ] |
| Official Symbol | PPARD |
| Synonyms | PPARD; peroxisome proliferator-activated receptor delta; peroxisome proliferative activated receptor, delta; FAAR; NR1C2; NUC1; NUCII; PPAR-beta; PPAR-delta; nuclear hormone receptor 1; nuclear receptor subfamily 1 group C member 2; peroxisome proliferator-activated receptor beta; peroxisome proliferator-activated nuclear receptor beta/delta variant 2; NUCI; PPARB; MGC3931; |
| Gene ID | 5467 |
| mRNA Refseq | NM_001171818 |
| Protein Refseq | NP_001165289 |
| MIM | 600409 |
| UniProt ID | Q03181 |
| Chromosome Location | 6p21.2 |
| Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adipogenesis, organism-specific biosystem; Energy Metabolism, organism-specific biosystem; Gene ex |
| Function | DNA binding; drug binding; fatty acid binding; ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity; linoleic acid binding; lipid binding; metal ion binding; receptor activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; steroid hormone receptor activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| PPARD-326H | Recombinant Human PPARD protein, MYC/DDK-tagged | +Inquiry |
| PPARD-4305HFL | Recombinant Full Length Human PPARD protein, Flag-tagged | +Inquiry |
| PPARD-6538H | Recombinant Human PPARD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PPARD-1088H | Recombinant Human PPARD, Ligand Binding Domain, His-tagged | +Inquiry |
| PPARD-13161M | Recombinant Mouse PPARD Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPARD-2986HCL | Recombinant Human PPARD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPARD Products
Required fields are marked with *
My Review for All PPARD Products
Required fields are marked with *
