Recombinant Human PPBP Protein

Cat.No. : PPBP-227H
Product Overview : Recombinant Human PPBP Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Neutrophil activating peptide 2 (NAP-2), also known as CXCL7, is a member of the CXC family of chemokines. NAP-2 is a carboxyl-terminal fragment produced by proteolytic cleavage of the platelet basic protein (PBP). NAP-2 is released from platelets and binds to the receptors CXCR1 and CXCR2 to chemoattract and activate neutrophils during inflammatory events.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 7.6 kDa (70 amino acids)
AA Sequence : AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Endotoxin : ≤1 EUs/μg, Kinetic LAL (50% confidence)
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) [ Homo sapiens (human) ]
Official Symbol PPBP
Synonyms PPBP; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); THBGB1; platelet basic protein; b TG1; Beta TG; beta thromboglobulin; connective tissue activating peptide III; CTAP3; CTAPIII; CXCL7; LA PF4; LDGF; MDGF; NAP 2; NAP 2 L1; neutrophil activating peptide 2; PBP; SCYB7; TGB; TGB1; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity platelet factor IV; neutrophil-activating peptide 2; neutrophil-activating peptide-2; macrophage-derived growth factor; connective tissue-activating peptide III; small inducible cytokine subfamily B, member 7; TC1; TC2; B-TG1; NAP-2; THBGB; LA-PF4; SCAR10; Beta-TG; CTAP-III;
Gene ID 5473
mRNA Refseq NM_002704
Protein Refseq NP_002695
MIM 121010
UniProt ID P02775

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPBP Products

Required fields are marked with *

My Review for All PPBP Products

Required fields are marked with *

0
cart-icon
0
compare icon