Recombinant Human PPBP protein, GST-tagged

• Cat.No.: PPBP-3363H
• Product Overview: Recombinant Human PPBP protein(P02775)(59-125aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 59-125aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.4 kDa
• AA Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) [ Homo sapiens ]
• Official Symbol: PPBP
• Synonyms: PPBP; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); THBGB1; platelet basic protein; b TG1; Beta TG; beta thromboglobulin; connective tissue activating peptide III; CTAP3; CTAPIII; CXCL7; LA PF4; LDGF; MDGF; NAP 2; NAP 2 L1; neutrophil activating peptide 2; PBP; SCYB7; TGB; TGB1; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity platelet factor IV; neutrophil-activating peptide 2; neutrophil-activating peptide-2; macrophage-derived growth factor; connective tissue-activating peptide III; small inducible cytokine subfamily B, member 7; TC1; TC2; B-TG1; NAP-2; THBGB; LA-PF4; SCAR10; Beta-TG; CTAP-III
• Gene ID: 5473
• mRNA Refseq: NM_002704
• Protein Refseq: NP_002695
• MIM: 121010
• UniProt ID: P02775