Recombinant Human PPBP protein, GST-tagged
| Cat.No. : | PPBP-3363H |
| Product Overview : | Recombinant Human PPBP protein(P02775)(59-125aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 59-125aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 34.4 kDa |
| AA Sequence : | AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PPBP pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) [ Homo sapiens ] |
| Official Symbol | PPBP |
| Synonyms | PPBP; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); THBGB1; platelet basic protein; b TG1; Beta TG; beta thromboglobulin; connective tissue activating peptide III; CTAP3; CTAPIII; CXCL7; LA PF4; LDGF; MDGF; NAP 2; NAP 2 L1; neutrophil activating peptide 2; PBP; SCYB7; TGB; TGB1; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity platelet factor IV; neutrophil-activating peptide 2; neutrophil-activating peptide-2; macrophage-derived growth factor; connective tissue-activating peptide III; small inducible cytokine subfamily B, member 7; TC1; TC2; B-TG1; NAP-2; THBGB; LA-PF4; SCAR10; Beta-TG; CTAP-III; |
| Gene ID | 5473 |
| mRNA Refseq | NM_002704 |
| Protein Refseq | NP_002695 |
| MIM | 121010 |
| UniProt ID | P02775 |
| ◆ Recombinant Proteins | ||
| PPBP-5943H | Recombinant Human PPBP Protein (Ala59-Asp128), His tagged | +Inquiry |
| Ppbp-2162M | Recombinant Mouse Ppbp protein, His-tagged | +Inquiry |
| PPBP-215P | Active Recombinant Human PPBP Protein (70 aa) | +Inquiry |
| PPBP-2149H | Recombinant Human PPBP Protein (Ala59-Asp128) | +Inquiry |
| Ppbp-630R | Recombinant Rat Ppbp protein | +Inquiry |
| ◆ Native Proteins | ||
| PPBP-30279TH | Native Human PPBP | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPBP-1616RCL | Recombinant Rat PPBP cell lysate | +Inquiry |
| PPBP-1397CCL | Recombinant Cynomolgus PPBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPBP Products
Required fields are marked with *
My Review for All PPBP Products
Required fields are marked with *
