Recombinant Human PPIA protein, His&Myc-tagged
| Cat.No. : | PPIA-4080H |
| Product Overview : | Recombinant Human PPIA protein(P62937)(1-165aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-165aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 23.0 kDa |
| AA Sequence : | MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PPIA peptidylprolyl isomerase A (cyclophilin A) [ Homo sapiens ] |
| Official Symbol | PPIA |
| Synonyms | PPIA; peptidylprolyl isomerase A (cyclophilin A); peptidyl-prolyl cis-trans isomerase A; CYPA; PPIase A; rotamase A; cyclophilin; T cell cyclophilin; cyclosporin A-binding protein; CYPH; MGC12404; MGC23397; MGC117158; |
| Gene ID | 5478 |
| mRNA Refseq | NM_021130 |
| Protein Refseq | NP_066953 |
| MIM | 123840 |
| UniProt ID | P62937 |
| ◆ Recombinant Proteins | ||
| PPIA-2096E | Recombinant Escherichia coli O157:H7 PPIA Protein (25-190 aa), His-SUMO-tagged | +Inquiry |
| Ppia-5038M | Recombinant Full Length Mouse Ppia Protein, Myc/DDK-tagged | +Inquiry |
| PPIA-5692R | Recombinant Rhesus monkey PPIA protein, His-tagged | +Inquiry |
| PPIA-4005C | Recombinant Chicken PPIA | +Inquiry |
| Ppia-7385M | Recombinant Mouse Ppia Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPIA-396HKCL | Human PPIA Knockdown Cell Lysate | +Inquiry |
| PPIA-2975HCL | Recombinant Human PPIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIA Products
Required fields are marked with *
My Review for All PPIA Products
Required fields are marked with *
