Recombinant Human PPIF protein
| Cat.No. : | PPIF-543H |
| Product Overview : | Recombinant Human PPIF protein was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 178 |
| Description : | CyP-D is a part of the peptidyl-prolyl cis-trans isomerase (PPIase) family. CyP-D accelerates the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. CyP-D is key component of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. |
| Form : | Supplied as a 0.2 μm filtered solution in PBS, pH7.4, with 1 mM DTT, 10 % glycerol. |
| Molecular Mass : | Approximately 18.9 kDa, a single non-glycosylated polypeptide chain containing 178 amino acids. |
| AA Sequence : | CSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS |
| Endotoxin : | Less than 0.1 EU/μg of rHuCyP-D as determined by LAL method. |
| Purity : | >95% by SDS-PAGE and HPLC analyses. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
| Gene Name | PPIF |
| Official Symbol | PPIF |
| Synonyms | PPIF; peptidylprolyl isomerase F; peptidylprolyl isomerase F (cyclophilin F); peptidyl-prolyl cis-trans isomerase F, mitochondrial; cyclophilin D; Cyp D; hCyP3; PPIase F; rotamase F; cyclophilin 3; cyclophilin F; peptidyl-prolyl cis-trans isomerase, mitochondrial; CYP3; Cyp-D; FLJ90798; MGC117207; |
| Gene ID | 10105 |
| mRNA Refseq | NM_005729 |
| Protein Refseq | NP_005720 |
| MIM | 604486 |
| UniProt ID | P30405 |
| ◆ Recombinant Proteins | ||
| PPIF-0851H | Recombinant Human PPIF Protein (S43-S207), His tagged | +Inquiry |
| PPIF-6983M | Recombinant Mouse PPIF Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ppif-109R | Recombinant Rat Ppif, His-tagged | +Inquiry |
| PPIF-120H | Recombinant Human Peptidylprolyl isomerase F | +Inquiry |
| PPIF-0852H | Recombinant Human PPIF Protein (S43-S207), Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPIF-2970HCL | Recombinant Human PPIF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIF Products
Required fields are marked with *
My Review for All PPIF Products
Required fields are marked with *
