Recombinant Human PPIF protein

Cat.No. : PPIF-543H
Product Overview : Recombinant Human PPIF protein was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 178
Description : CyP-D is a part of the peptidyl-prolyl cis-trans isomerase (PPIase) family. CyP-D accelerates the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. CyP-D is key component of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.
Form : Supplied as a 0.2 μm filtered solution in PBS, pH7.4, with 1 mM DTT, 10 % glycerol.
Molecular Mass : Approximately 18.9 kDa, a single non-glycosylated polypeptide chain containing 178 amino acids.
AA Sequence : CSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Endotoxin : Less than 0.1 EU/μg of rHuCyP-D as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
Gene Name PPIF
Official Symbol PPIF
Synonyms PPIF; peptidylprolyl isomerase F; peptidylprolyl isomerase F (cyclophilin F); peptidyl-prolyl cis-trans isomerase F, mitochondrial; cyclophilin D; Cyp D; hCyP3; PPIase F; rotamase F; cyclophilin 3; cyclophilin F; peptidyl-prolyl cis-trans isomerase, mitochondrial; CYP3; Cyp-D; FLJ90798; MGC117207;
Gene ID 10105
mRNA Refseq NM_005729
Protein Refseq NP_005720
MIM 604486
UniProt ID P30405

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPIF Products

Required fields are marked with *

My Review for All PPIF Products

Required fields are marked with *

0
cart-icon