Recombinant Human PPIF Protein, His-tagged
Cat.No. : | PPIF-143H |
Product Overview : | Recombinant Human PPIF Protien(NP_005720)(1-207 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-207 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | PPIF peptidylprolyl isomerase F [ Homo sapiens ] |
Official Symbol | PPIF |
Synonyms | PPIF; peptidylprolyl isomerase F; peptidylprolyl isomerase F (cyclophilin F); peptidyl-prolyl cis-trans isomerase F, mitochondrial; cyclophilin D; Cyp D; hCyP3; PPIase F; rotamase F; cyclophilin 3; cyclophilin F; peptidyl-prolyl cis-trans isomerase, mitochondrial; CYP3; Cyp-D; FLJ90798; MGC117207; |
Gene ID | 10105 |
mRNA Refseq | NM_005729 |
Protein Refseq | NP_005720 |
MIM | 604486 |
UniProt ID | P30405 |
◆ Recombinant Proteins | ||
PPIF-27049TH | Recombinant Human PPIF | +Inquiry |
PPIF-13184M | Recombinant Mouse PPIF Protein | +Inquiry |
PPIF-159H | Recombinant Human PPIF protein, T7-tagged | +Inquiry |
Ppif-5555M | Recombinant Mouse Ppif Protein (Cys30-Ser206), N-His tagged | +Inquiry |
PPIF-143H | Recombinant Human PPIF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIF-2970HCL | Recombinant Human PPIF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPIF Products
Required fields are marked with *
My Review for All PPIF Products
Required fields are marked with *
0
Inquiry Basket