Recombinant Human PPIF Protein, His-tagged
| Cat.No. : | PPIF-143H |
| Product Overview : | Recombinant Human PPIF Protien(NP_005720)(1-207 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 13, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-207 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | PPIF peptidylprolyl isomerase F [ Homo sapiens ] |
| Official Symbol | PPIF |
| Synonyms | PPIF; peptidylprolyl isomerase F; peptidylprolyl isomerase F (cyclophilin F); peptidyl-prolyl cis-trans isomerase F, mitochondrial; cyclophilin D; Cyp D; hCyP3; PPIase F; rotamase F; cyclophilin 3; cyclophilin F; peptidyl-prolyl cis-trans isomerase, mitochondrial; CYP3; Cyp-D; FLJ90798; MGC117207; |
| Gene ID | 10105 |
| mRNA Refseq | NM_005729 |
| Protein Refseq | NP_005720 |
| MIM | 604486 |
| UniProt ID | P30405 |
| ◆ Recombinant Proteins | ||
| PPIF-120H | Recombinant Human Peptidylprolyl isomerase F | +Inquiry |
| PPIF-6983M | Recombinant Mouse PPIF Protein, His (Fc)-Avi-tagged | +Inquiry |
| PPIF-543H | Recombinant Human PPIF protein | +Inquiry |
| PPIF-2888C | Recombinant Chicken PPIF | +Inquiry |
| PPIF-4262R | Recombinant Rat PPIF Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPIF-2970HCL | Recombinant Human PPIF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIF Products
Required fields are marked with *
My Review for All PPIF Products
Required fields are marked with *
