Recombinant Human PPIL1, His-tagged

• Cat.No.: PPIL1-29971TH
• Product Overview: Recombinant full length human PPIL1, fused to His tag at C terminus; 174 amino acids, 19.3 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
• Conjugation: HIS
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFA ELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ WLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII KAYPSGLEHHHHHH
• Full Length: Full L.

Gene Information

• Gene Name: PPIL1 peptidylprolyl isomerase (cyclophilin)-like 1 [ Homo sapiens ]
• Official Symbol: PPIL1
• Synonyms: PPIL1; peptidylprolyl isomerase (cyclophilin)-like 1; peptidyl-prolyl cis-trans isomerase-like 1; CYPL1
• Gene ID: 51645
• mRNA Refseq: NM_016059
• Protein Refseq: NP_057143
• MIM: 601301
• Uniprot ID: Q9Y3C6
• Chromosome Location: 6p21.1
• Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem
• Function: isomerase activity; peptidyl-prolyl cis-trans isomerase activity