Recombinant Human PPIL1, His-tagged
| Cat.No. : | PPIL1-29971TH |
| Product Overview : | Recombinant full length human PPIL1, fused to His tag at C terminus; 174 amino acids, 19.3 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. |
| Conjugation : | HIS |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFA ELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGK QFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ WLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKII KAYPSGLEHHHHHH |
| Full Length : | Full L. |
| Gene Name | PPIL1 peptidylprolyl isomerase (cyclophilin)-like 1 [ Homo sapiens ] |
| Official Symbol | PPIL1 |
| Synonyms | PPIL1; peptidylprolyl isomerase (cyclophilin)-like 1; peptidyl-prolyl cis-trans isomerase-like 1; CYPL1; |
| Gene ID | 51645 |
| mRNA Refseq | NM_016059 |
| Protein Refseq | NP_057143 |
| MIM | 601301 |
| Uniprot ID | Q9Y3C6 |
| Chromosome Location | 6p21.1 |
| Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem; |
| Function | isomerase activity; peptidyl-prolyl cis-trans isomerase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIL1 Products
Required fields are marked with *
My Review for All PPIL1 Products
Required fields are marked with *
