Recombinant Human PPIL1 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: PPIL1-410H
• Product Overview: PPIL1 MS Standard C13 and N15-labeled recombinant protein (NP_057143) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq, Jul 2008]
• Molecular Mass: 18.2 kDa
• AA Sequence: MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PPIL1 peptidylprolyl isomerase (cyclophilin)-like 1 [ Homo sapiens (human) ]
• Official Symbol: PPIL1
• Synonyms: PPIL1; peptidylprolyl isomerase (cyclophilin)-like 1; peptidyl-prolyl cis-trans isomerase-like 1; CYPL1; rotamase PPIL1; cyclophilin-related gene 1; peptidyl-prolyl cis-trans isomerase; hCyPX; PPIase; CGI-124; MGC678
• Gene ID: 51645
• mRNA Refseq: NM_016059
• Protein Refseq: NP_057143
• MIM: 601301
• UniProt ID: Q9Y3C6