"PPIL1" Related Products

Expand
Expand

Recombinant Human PPIL1 protein, T7-tagged

Cat.No.: PPIL1-177H
Product Overview: Recombinant human PPIL1 (166 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFGSMAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIK DFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVC QGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro SKIP related spliceosome regulation study with intracellular protein delivery of this protein.2. As soluble/native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PPIL1 protein–protein interaction assay development.4. May be used as antigen for specific antibody development.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: PPIL1 peptidylprolyl isomerase (cyclophilin)-like 1 [ Homo sapiens ]
Official Symbol: PPIL1
Synonyms: PPIL1; peptidylprolyl isomerase (cyclophilin)-like 1; peptidyl-prolyl cis-trans isomerase-like 1; CYPL1; rotamase PPIL1; cyclophilin-related gene 1; peptidyl-prolyl cis-trans isomerase; hCyPX; PPIase; CGI-124; MGC678;
Gene ID: 51645
mRNA Refseq: NM_016059
Protein Refseq: NP_057143
MIM: 601301
UniProt ID: Q9Y3C6
Chromosome Location: 6p21.1
Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, 35S U5-snRNP, organism-specific biosystem;
Function: isomerase activity; peptidyl-prolyl cis-trans isomerase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.