Recombinant Human PPP1R11 protein, GST-tagged
Cat.No. : | PPP1R11-3017H |
Product Overview : | Recombinant Human PPP1R11 (1-126 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-His126 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PPP1R11 protein phosphatase 1 regulatory inhibitor subunit 11 [ Homo sapiens (human) ] |
Official Symbol | PPP1R11 |
Synonyms | HCGV; IPP3; HCG-V; TCTE5; TCTEX5; CFAP255 |
Gene ID | 6992 |
mRNA Refseq | NM_021959 |
Protein Refseq | NP_068778.1 |
MIM | 606670 |
UniProt ID | O60927 |
◆ Recombinant Proteins | ||
PPP1R11-807H | Recombinant Human PPP1R11 | +Inquiry |
PPP1R11-2753H | Recombinant Human PPP1R11 Protein, MYC/DDK-tagged | +Inquiry |
PPP1R11-3017H | Recombinant Human PPP1R11 protein, GST-tagged | +Inquiry |
Ppp1r11-5057M | Recombinant Mouse Ppp1r11 Protein, Myc/DDK-tagged | +Inquiry |
PPP1R11-4613R | Recombinant Rat PPP1R11 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R11 Products
Required fields are marked with *
My Review for All PPP1R11 Products
Required fields are marked with *