Recombinant Human PPP1R11 protein, GST-tagged
| Cat.No. : | PPP1R11-3017H |
| Product Overview : | Recombinant Human PPP1R11 (1-126 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-His126 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | PPP1R11 protein phosphatase 1 regulatory inhibitor subunit 11 [ Homo sapiens (human) ] |
| Official Symbol | PPP1R11 |
| Synonyms | HCGV; IPP3; HCG-V; TCTE5; TCTEX5; CFAP255 |
| Gene ID | 6992 |
| mRNA Refseq | NM_021959 |
| Protein Refseq | NP_068778.1 |
| MIM | 606670 |
| UniProt ID | O60927 |
| ◆ Recombinant Proteins | ||
| PPP1R11-4272R | Recombinant Rat PPP1R11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PPP1R11-2616H | Recombinant Human PPP1R11 Protein, His-tagged | +Inquiry |
| PPP1R11-3379R | Recombinant Rhesus Macaque PPP1R11 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PPP1R11-3561R | Recombinant Rhesus monkey PPP1R11 Protein, His-tagged | +Inquiry |
| PPP1R11-2753H | Recombinant Human PPP1R11 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R11 Products
Required fields are marked with *
My Review for All PPP1R11 Products
Required fields are marked with *




