Recombinant Human PPP1R15A Protein, GST-tagged

Cat.No. : PPP1R15A-15H
Product Overview : Recombinant Human TRY partial ORF ( AAH03067, 1 a.a. - 100 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-100 a.a.
Description : Protein phosphatase 1 regulatory subunit 15A also known as growth arrest and DNA damage-inducible protein GADD34 is a protein that in humans is encoded by the PPP1R15A gene.
Molecular Mass : 36.63 kDa
AA Sequence : MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAVKGAALVEAGLEGEARTPLAIPHTPWGRRPEEEAEDSGGPGEDRETLGLKT
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PPP1R15A protein phosphatase 1 regulatory subunit 15A [ Homo sapiens (human) ]
Official Symbol PPP1R15A
Synonyms GADD34
Gene ID 23645
mRNA Refseq BC003067
Protein Refseq AAH03067
MIM 611048
UniProt ID O75807
Chromosome Location 19q13.33

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R15A Products

Required fields are marked with *

My Review for All PPP1R15A Products

Required fields are marked with *

0
cart-icon
0
compare icon