Recombinant Human PPP1R15A Protein, GST-tagged
Cat.No. : | PPP1R15A-15H |
Product Overview : | Recombinant Human TRY partial ORF ( AAH03067, 1 a.a. - 100 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-100 a.a. |
Description : | Protein phosphatase 1 regulatory subunit 15A also known as growth arrest and DNA damage-inducible protein GADD34 is a protein that in humans is encoded by the PPP1R15A gene. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAVKGAALVEAGLEGEARTPLAIPHTPWGRRPEEEAEDSGGPGEDRETLGLKT |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PPP1R15A protein phosphatase 1 regulatory subunit 15A [ Homo sapiens (human) ] |
Official Symbol | PPP1R15A |
Synonyms | GADD34 |
Gene ID | 23645 |
mRNA Refseq | BC003067 |
Protein Refseq | AAH03067 |
MIM | 611048 |
UniProt ID | O75807 |
Chromosome Location | 19q13.33 |
◆ Recombinant Proteins | ||
PPP1R15A-4619R | Recombinant Rat PPP1R15A Protein | +Inquiry |
PPP1R15A-2441HFL | Recombinant Full Length Human PPP1R15A protein, Flag-tagged | +Inquiry |
PPP1R15A-15H | Recombinant Human PPP1R15A Protein, GST-tagged | +Inquiry |
PPP1R15A-5291Z | Recombinant Zebrafish PPP1R15A | +Inquiry |
Ppp1r15a-5064M | Recombinant Mouse Ppp1r15a Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R15A-2943HCL | Recombinant Human PPP1R15A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R15A Products
Required fields are marked with *
My Review for All PPP1R15A Products
Required fields are marked with *