Recombinant Human PPP1R15A Protein, GST-tagged

• Cat.No.: PPP1R15A-15H
• Product Overview: Recombinant Human TRY partial ORF ( AAH03067, 1 a.a. - 100 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-100 a.a.
• Description: Protein phosphatase 1 regulatory subunit 15A also known as growth arrest and DNA damage-inducible protein GADD34 is a protein that in humans is encoded by the PPP1R15A gene.
• Molecular Mass: 36.63 kDa
• AA Sequence: MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAVKGAALVEAGLEGEARTPLAIPHTPWGRRPEEEAEDSGGPGEDRETLGLKT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PPP1R15A protein phosphatase 1 regulatory subunit 15A [ Homo sapiens (human) ]
• Official Symbol: PPP1R15A
• Synonyms: GADD34
• Gene ID: 23645
• mRNA Refseq: BC003067
• Protein Refseq: AAH03067
• MIM: 611048
• UniProt ID: O75807
• Chromosome Location: 19q13.33