Recombinant Human PPP1R15A protein, His-tagged

• Cat.No.: PPP1R15A-4491H
• Product Overview: Recombinant Human PPP1R15A protein(O75807)(40-674aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 40-674aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 73.2 kDa
• AA Sequence: SDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAG
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PPP1R15A protein phosphatase 1, regulatory subunit 15A [ Homo sapiens ]
• Official Symbol: PPP1R15A
• Synonyms: PPP1R15A; protein phosphatase 1, regulatory subunit 15A; protein phosphatase 1, regulatory (inhibitor) subunit 15A; protein phosphatase 1 regulatory subunit 15A; GADD34; growth arrest and DNA damage inducible 34; growth arrest and DNA-damage-inducible 34; growth arrest and DNA damage-inducible protein GADD34; myeloid differentiation primary response protein MyD116 homolog
• Gene ID: 23645
• mRNA Refseq: NM_014330
• Protein Refseq: NP_055145
• MIM: 611048
• UniProt ID: O75807