Recombinant Human PPP1R15A protein, His-tagged
| Cat.No. : | PPP1R15A-4491H |
| Product Overview : | Recombinant Human PPP1R15A protein(O75807)(40-674aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 40-674aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 73.2 kDa |
| AA Sequence : | SDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAG |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | PPP1R15A protein phosphatase 1, regulatory subunit 15A [ Homo sapiens ] |
| Official Symbol | PPP1R15A |
| Synonyms | PPP1R15A; protein phosphatase 1, regulatory subunit 15A; protein phosphatase 1, regulatory (inhibitor) subunit 15A; protein phosphatase 1 regulatory subunit 15A; GADD34; growth arrest and DNA damage inducible 34; growth arrest and DNA-damage-inducible 34; growth arrest and DNA damage-inducible protein GADD34; myeloid differentiation primary response protein MyD116 homolog; |
| Gene ID | 23645 |
| mRNA Refseq | NM_014330 |
| Protein Refseq | NP_055145 |
| MIM | 611048 |
| UniProt ID | O75807 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R15A Products
Required fields are marked with *
My Review for All PPP1R15A Products
Required fields are marked with *



