Recombinant Human PPP1R15A protein, His-tagged

Cat.No. : PPP1R15A-4491H
Product Overview : Recombinant Human PPP1R15A protein(O75807)(40-674aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 40-674aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 73.2 kDa
AA Sequence : SDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDTEEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSASTPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKETEEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSEKVTVHFLAVWAG
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name PPP1R15A protein phosphatase 1, regulatory subunit 15A [ Homo sapiens ]
Official Symbol PPP1R15A
Synonyms PPP1R15A; protein phosphatase 1, regulatory subunit 15A; protein phosphatase 1, regulatory (inhibitor) subunit 15A; protein phosphatase 1 regulatory subunit 15A; GADD34; growth arrest and DNA damage inducible 34; growth arrest and DNA-damage-inducible 34; growth arrest and DNA damage-inducible protein GADD34; myeloid differentiation primary response protein MyD116 homolog;
Gene ID 23645
mRNA Refseq NM_014330
Protein Refseq NP_055145
MIM 611048
UniProt ID O75807

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R15A Products

Required fields are marked with *

My Review for All PPP1R15A Products

Required fields are marked with *

0
cart-icon